CAZyme Information: MGYG000002533_03272

Basic Information

• Species: Vibrio vulnificus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio vulnificus
• CAZyme ID: MGYG000002533_03272
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155	MGYG000002533_8|CGC3	17989.21	9.4079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002533	4933179	Isolate	Bangladesh	Asia

• Gene Location: Start: 141870; End: 142337 Strand: +

Full Sequence      

MQKFVLLTTLLLSPLVMAKEPVRSISSNGFDKQHKPEHVLDGSNKTRWANKGDSWLMFEF
EQLTTLQHIDLTIFKGDERKQHFDLEVSRDGMQWQKVFSASTSGATKAKERYRFSPSQAR
YARVNAYGTDVSKSWSGFHQIQFNSEEQVEHQFDK

Enzyme Prediction     

No EC number prediction in MGYG000002533_03272.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	27	132	1.2e-18	0.8225806451612904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	3.09e-10	26	136	5	122	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam17132	Glyco_hydro_106	4.62e-04	52	124	206	282	alpha-L-rhamnosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV89318.1	1.40e-110	1	155	1	155
ANH66086.1	1.40e-110	1	155	1	155
ARN68789.1	1.40e-110	1	155	1	155
ALM73724.1	1.40e-110	1	155	1	155
AIL73346.1	1.40e-110	1	155	1	155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JD9_A	6.59e-25	24	145	12	135	Structureof a pectin binding carbohydrate binding module determined in an orthorhombic crystal form. [Yersinia enterocolitica],2JDA_A Structure of a pectin binding carbohydrate binding module determined in an monoclinic crystal form. [Yersinia enterocolitica],2JDA_B Structure of a pectin binding carbohydrate binding module determined in an monoclinic crystal form. [Yersinia enterocolitica]
7D29_A	5.03e-15	36	141	24	129	CBM32of AlyQ [Persicobacter sp. CCB-QB2],7D2A_A CBM32 of AlyQ in complex with 4,5-unsaturated mannuronic acid [Persicobacter sp. CCB-QB2]
5XNR_A	6.63e-14	36	141	24	129	TruncatedAlyQ with CBM32 and alginate lyase domains [Persicobacter sp. CCB-QB2]
5ZU6_A	6.30e-13	36	136	47	149	ACBM32 derived from alginate lyase B (AlyB-OU02) [Vibrio]
5ZU5_A	4.07e-12	36	136	47	149	Crystalstructure of a full length alginate lyase with CBM domain [Vibrio splendidus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000350	0.998887	0.000206	0.000175	0.000173	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002533_03272.