CAZyme Information: MGYG000002533_03621

Basic Information

• Species: Vibrio vulnificus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio vulnificus
• CAZyme ID: MGYG000002533_03621
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38268.13	7.8021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002533	4933179	Isolate	Bangladesh	Asia

• Gene Location: Start: 7421; End: 8455 Strand: -

Full Sequence      

MKKILVIRNDKIGDFMLAWPSFAMLKQSMPEAHITALVPSYTQELARLCPWIDDVLLDPT
EKAGKEATKQLVQEIKSRQFDASINLFSTTYNALLVWKAGIKYRLAPATKIAQIFYNRRI
KQKRSQSAKPEYQYNLDLIRAFLKEQNLSAVEPQAPFLLFDETELSVQKLKLSEQLSIEA
HKPWVMVHAGTGGSANNLTLAQYAELLKGIEQDFQLIVTAGPGETEKAQQLLKEYAQLGG
QGVVYDKNEGLVDFTRSIACADLFIAGSTGPLHIAATLDVPTVGFFPSKRSSTPLRWKPL
NSEGRHLAFCPPKGGGEAMEADMSRIDIDAALVQLNPWVSPYLS

Enzyme Prediction     

No EC number prediction in MGYG000002533_03621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	69	305	2.2e-35	0.8755555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	4.83e-80	1	340	1	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.63e-58	3	332	1	272	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	1.85e-15	71	301	4	221	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.06e-09	2	286	6	288	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND99858.1	6.31e-251	1	344	1	344
AVX00230.1	6.31e-251	1	344	1	344
ASJ39877.1	6.31e-251	1	344	1	344
QET75125.1	6.31e-251	1	344	1	344
AUL94304.1	6.31e-251	1	344	1	344

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44011	2.30e-131	1	339	1	336	Putative glycosyltransferase HI_0523 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0523 PE=3 SV=2
Q57336	7.16e-09	2	302	9	294	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
Q9R9D5	5.42e-06	13	302	5	289	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002533_03621.