CAZyme Information: MGYG000002534_01824

Basic Information

• Species: Citrobacter_A farmeri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A farmeri
• CAZyme ID: MGYG000002534_01824
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000002534_1|CGC31	22486.6	9.9055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002534	5715629	Isolate	Australia	Oceania

• Gene Location: Start: 1922662; End: 1923276 Strand: +

Full Sequence      

MKQSQFQQAAGISAGLAARWFLHIDAAMKEFGITAINDQAMFIAQVGHESAGFTSLVESF
NYSVNGLKKTFGKRLTPYQCEMLGRVDGKQVAHQPQIANLVYGDRMGNNSPGDGWKYRGR
GLLQITGRENYTKCGSALKLDLVSTPELLTQERHSARSAAWYFTLSGCLLHSGDVERVTQ
IINGGQNGIKDRRERYAKAKAVLV

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	34	185	2.1e-33	0.5021645021645021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	2.89e-87	1	204	4	205	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	1.99e-07	2	185	2	189	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST79291.1	5.33e-148	1	204	1	204
QZA37452.1	1.47e-145	1	204	1	204
AKE59024.1	6.98e-144	1	204	1	204
QFS72210.1	9.91e-144	1	204	1	204
AVX50979.1	2.62e-139	1	204	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	9.95e-85	1	203	16	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
2CJL_A	1.12e-06	3	163	15	138	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
4MST_A	6.72e-06	114	163	105	155	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	1.82e-29	24	196	25	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	3.39e-10	8	202	187	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002534_01824.