CAZyme Information: MGYG000002534_02068

Basic Information

• Species: Citrobacter_A farmeri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A farmeri
• CAZyme ID: MGYG000002534_02068
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245	MGYG000002534_1|CGC34	27791.63	9.38

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002534	5715629	Isolate	Australia	Oceania

• Gene Location: Start: 2158677; End: 2159414 Strand: +

Full Sequence      

MMTLYMYWPQVVWAVLVLLGLGIELARYGQARTGKHSFWWQLFGSVTVAWLLWCGGFFSQ
ARAAQPPQTALQYRDDVIRNARLEWGMSAPVADFAAQLHQESGWRPDAVSPVGAQGLAQF
MPTTADWISQLMPGLNSREPFNPSWAIRALVSYDRWLWQRVSAVNDCERMAMTLSGYNGG
LGWVQRDKRLASQQGLDSTRWFGHVATVNAGRSTANWRENRHYPQRILHELAPRYLTWGG
GSCVD

Enzyme Prediction     

No EC number prediction in MGYG000002534_02068.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	93	229	5.9e-18	0.7481481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.15e-27	95	222	16	137	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	9.18e-22	90	182	4	96	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd16896	LT_Slt70-like	6.13e-17	71	229	2	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	8.28e-17	83	232	282	436	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd00254	LT-like	3.13e-16	94	228	4	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXX04240.1	3.73e-191	1	245	1	245
AST79516.1	3.73e-191	1	245	1	245
BAE74105.1	3.73e-191	1	245	1	245
ASV20922.1	2.16e-190	1	245	1	245
QHF78700.1	2.16e-190	1	245	1	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	3.03e-08	30	185	416	560	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	2.38e-07	30	185	416	560	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1U3J1	2.24e-10	76	202	292	406	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q2SK06	5.51e-10	83	202	315	422	Membrane-bound lytic murein transglycosylase F OS=Hahella chejuensis (strain KCTC 2396) OX=349521 GN=mltF PE=3 SV=1
A1S850	1.77e-09	94	201	299	400	Membrane-bound lytic murein transglycosylase F OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=mltF PE=3 SV=2
B0TLJ6	3.18e-09	94	201	296	397	Membrane-bound lytic murein transglycosylase F OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=mltF PE=3 SV=1
A8H256	5.79e-09	94	201	296	397	Membrane-bound lytic murein transglycosylase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
39	61