CAZyme Information: MGYG000002534_02887

Basic Information

• Species: Citrobacter_A farmeri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A farmeri
• CAZyme ID: MGYG000002534_02887
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		21782.2	5.0554

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002534	5715629	Isolate	Australia	Oceania

• Gene Location: Start: 2993673; End: 2994263 Strand: -

Full Sequence      

MNNTPDSPAFRNALTFVLSAERGYVNDPTDRGGETNLGISDKRDGVADGKTDVDGDGKPD
TRIRDLTVEQAGQIYFRDYWYPAYCPLWPDEVALFVFDSAVQHGAKKAVQLLQEAVGFTG
KSVDGIAGKNTRAAVESADPDWLMNRLYLRRSRYYADIIKSNPSQGKFLNGWFNRLDNLA
DACREISGVQYSVARS

Enzyme Prediction     

No EC number prediction in MGYG000002534_02887.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	14	104	9.3e-23	0.9767441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13926	N-acetylmuramidase_GH108	7.53e-31	9	104	2	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam05838	Glyco_hydro_108	1.54e-27	14	104	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
COG3926	ZliS	1.38e-26	10	175	5	160	Lysozyme family protein [General function prediction only].
pfam09374	PG_binding_3	2.88e-14	108	176	2	75	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST80268.1	1.32e-144	1	196	1	196
AUZ65883.1	3.78e-144	1	196	1	196
QFS72723.1	3.78e-144	1	196	1	196
QLV31723.1	1.86e-135	1	196	1	196
QNB19157.1	1.86e-135	1	196	1	196

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IS5_A	2.68e-15	7	176	3	155	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	2.73e-15	7	176	2	154	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]
7DNP_A	1.98e-13	10	179	6	162	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]
2NR7_A	2.47e-12	14	179	11	192	StructuralGenomics, the crystal structure of putative secretion activator protein from Porphyromonas gingivalis W83 [Porphyromonas gingivalis W83]
6V3Z_A	5.11e-07	17	172	29	192	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002534_02887.