CAZyme Information: MGYG000002534_03378

Basic Information

• Species: Citrobacter_A farmeri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A farmeri
• CAZyme ID: MGYG000002534_03378
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000002534_1|CGC49	62153.42	9.2015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002534	5715629	Isolate	Australia	Oceania

• Gene Location: Start: 3498816; End: 3500471 Strand: +

Full Sequence      

MKNTRYYQILIALIAFWYIIPINLRLLWQPDETRYAEISREMLASGDWLVPHFLGVRYFE
KPIAGYWINSIGQWLFGANNFGVRAGAIFATLVTAALVGWLAMRLWRDTRTALLSVIIFL
SLFIVYGIGTYAVLDPLIALWLMAGLCCFWLAMQATTWHGKSVGFLLLGVTCGMGVMTKG
FLALAVPVLSVLPWVAAQKRWKDLFLFGGLAVISCVAVILPWGLAIAQREPDFWHYFFWV
EHIQRFAMDDAQHKAPFWYYLPVLIAGSLPWLALLPGALKTGWQARDESRGALYLLGWVV
MPLVFFSIAKGKLPTYILSCFAPLAILMARYGLNAAEKGYAALRINSWINILFGVVGIIA
TLIVSPWGPLKSPVWGHIEVYKVFCSLGIFSLWTFFGWYTLSNTGKRWVYAALCPLALAL
LFGFSVPDRVMESKQPQFFVEMTRENLAPSRYILTDSVGVAAGLAWSLKRDDILMYGQTG
ELKYGLNYPDAKGRFIPYADFADWLSQHRQEGIITLVLTIAKDEDINRLAIPPADTIDNQ
GRLVLIQYHPK

Enzyme Prediction     

No EC number prediction in MGYG000002534_03378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	2	523	6.7e-151	0.9685185185185186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	1	550	2	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	3.62e-102	9	524	11	535	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	4.96e-44	9	237	5	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	5.48e-09	61	222	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST80734.1	0.0	1	551	1	551
QZE47906.1	0.0	1	551	13	563
QFS71066.1	0.0	1	551	1	551
AKE59276.1	0.0	1	551	1	551
AUO63597.1	0.0	1	551	1	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	8.19e-38	11	374	40	392	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7N5M2	0.0	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=arnT PE=3 SV=1
B7UFR9	0.0	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=arnT PE=3 SV=1
B7NNT6	0.0	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=arnT PE=3 SV=1
Q0TFI5	0.0	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=arnT PE=3 SV=1
A1ADA9	0.0	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O1:K1 / APEC OX=405955 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999953	0.000041	0.000010	0.000000	0.000000	0.000016

TMHMM  Annotations     

start	end
7	29
81	103
112	134
175	197
204	226
257	279
292	309
313	335
348	370
380	402
409	426