CAZyme Information: MGYG000002534_05387

Basic Information

• Species: Citrobacter_A farmeri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A farmeri
• CAZyme ID: MGYG000002534_05387
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158		17996.56	9.7339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002534	5715629	Isolate	Australia	Oceania

• Gene Location: Start: 111573; End: 112049 Strand: +

Full Sequence      

MKRIALTFLMLAFSGMLNAADCFDLAGRDYHIDPDLLRAISWNESNFRTYVKGYNPVSGF
GSGLMQVDSQHFNELARYGIKPEHLLSDPCMNIYTGAYYLAIAFKKWGVSWQAVGAYNAG
FRKTEEQAQRRYVYARKIEATYRAIKNNKNAAQTLAKQ

Enzyme Prediction     

No EC number prediction in MGYG000002534_05387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	33	150	1.1e-18	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13722	PRK13722	1.82e-75	1	149	1	149	lytic transglycosylase; Provisional
cd13400	LT_IagB-like	2.74e-43	30	143	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	4.47e-35	1	146	1	143	type III secretion system invasion protein IagB.
pfam01464	SLT	1.25e-19	26	140	4	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	6.18e-14	21	120	141	240	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV94289.1	1.10e-113	1	158	1	158
QIP22750.1	1.10e-113	1	158	1	158
QFH43760.1	1.10e-113	1	158	1	158
AUS92335.1	1.10e-113	1	158	1	158
BBV84459.1	1.10e-113	1	158	1	158

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	4.02e-17	21	105	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14499	4.73e-75	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	1.57e-73	1	149	1	149	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1
P17738	1.29e-72	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
Q00739	3.69e-72	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
E1WAC2	1.84e-22	20	146	19	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000576	0.997524	0.001164	0.000237	0.000234	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002534_05387.