CAZyme Information: MGYG000002535_02614

Basic Information

• Species: Citrobacter gillenii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter gillenii
• CAZyme ID: MGYG000002535_02614
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000002535_1|CGC31	34433.97	8.9592

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002535	4885099	Isolate	United States	North America

• Gene Location: Start: 2668288; End: 2669238 Strand: -

Full Sequence      

MIGDSKLLTSAAWDAQSLNELKAKAGQDPAANIRPVARQVEGMFVQMMLKSMREALPKDG
VFSSDSTRLYTSMYDQQVAQQMTAGKGLGLAEMMVKQMTEGQGTPADDAPQVPMKFSLET
VTSYQNQALTQMVRKALPKAVEGNDEPLSGDSKDFLAQLSLPAKLASQQSGVPHHLILAQ
AALESGWGQRQIRRENGEPSFNIFGVKASGSWKGPTTEITTTEYENGEAKKVKARFRVYS
SYLEALSDYVGLISRNPRYAAVTGAATAEQGAQALQNAGYATDPHYARKLTTMIQQLKSM
SEKVSKTYSSNLDNLF

Enzyme Prediction     

No EC number prediction in MGYG000002535_02614.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	164	297	3.1e-33	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	1.94e-174	2	312	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	3.35e-134	11	298	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12712	flgJ	2.74e-78	3	299	8	344	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12709	flgJ	1.40e-76	12	297	15	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	1.49e-71	11	299	15	328	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCA18995.1	2.78e-224	1	316	1	316
ATF50052.1	2.78e-224	1	316	1	316
QMR47302.1	1.13e-223	1	316	1	316
QBX80368.1	1.48e-219	1	316	1	316
AMH15041.1	5.77e-217	1	316	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	2.93e-101	151	316	2	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.49e-90	151	301	2	152	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	9.38e-40	163	294	12	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.23e-39	163	294	13	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	9.54e-39	163	294	13	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15931	3.86e-200	1	316	1	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	2.16e-187	1	316	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	7.22e-186	1	316	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9X9J3	2.08e-45	14	300	13	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	2.58e-43	14	299	20	387	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002535_02614.