CAZyme Information: MGYG000002536_00389

Basic Information

• Species: Plesiomonas shigelloides
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Plesiomonas; Plesiomonas shigelloides
• CAZyme ID: MGYG000002536_00389
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000002536_2|CGC1	40773.59	9.5771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002536	3653255	Isolate	not provided	not provided

• Gene Location: Start: 63979; End: 65058 Strand: -

Full Sequence      

MKKKLTWCVILPLLAACASKPKEDPSLYVKDTNGFDILMGQFSANIEDLWGLNEMLVASR
KDYVKYTDRYYTRSHIDFENGMVTVETIATQNPLDKLRNAMVHTLLMGDDPNGIDLFSDS
DVPFSKHPFLAGQVVDEQKKAITNQIQAGRFADYLLQTKLKSRQIGSRTVWYVDIPMIAN
HLNYRAKKYLHIVRKASRNYNVDESLILAIMQVESSFNPYAVSSANALGLMQVVQHTAGR
DVYNLVKNKDGTPSRDYLFDPEKNIDTGTAYLHILQTNYLANIRNPVSRRYAMISAYNGG
AGAVLRIFSQDKQKAVDIINSMSPDELYNVLTTRHPSAQARHYLYKVNTAQRNYRGRIV

Enzyme Prediction     

No EC number prediction in MGYG000002536_00389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	204	351	9.3e-23	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11671	mltC	0.0	1	357	1	359	membrane-bound lytic murein transglycosylase MltC.
cd16893	LT_MltC_MltE	8.57e-103	192	352	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
pfam11873	DUF3393	7.88e-87	28	188	1	161	Domain of unknown function (DUF3393). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 188 to 206 amino acids in length. This domain is found associated with pfam01464.
PRK15470	emtA	2.89e-49	171	350	27	199	membrane-bound lytic murein transglycosylase EmtA.
COG0741	MltE	2.43e-44	45	352	1	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWK96681.1	1.92e-264	1	359	1	359
QIY08517.1	7.83e-264	1	359	1	359
SBT61989.1	7.83e-264	1	359	1	359
QWK94101.1	7.83e-264	1	359	1	359
AVQ88225.1	7.83e-264	1	359	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	2.35e-146	28	357	12	341	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	6.70e-146	28	357	12	341	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GI4_B	4.61e-40	172	350	5	182	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
3T36_A	8.38e-40	159	350	15	199	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
2Y8P_A	1.28e-39	172	350	5	182	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2NRB3	6.42e-157	1	355	1	356	Membrane-bound lytic murein transglycosylase C OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltC PE=3 SV=1
A6TDX1	2.89e-156	1	355	1	358	Membrane-bound lytic murein transglycosylase C OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=mltC PE=3 SV=2
C5BCE9	2.28e-155	1	355	1	356	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
B5XU88	9.56e-155	1	355	1	358	Membrane-bound lytic murein transglycosylase C OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=mltC PE=3 SV=1
A8GJ50	2.95e-153	1	357	1	358	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000034	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002536_00389.