CAZyme Information: MGYG000002536_00487

Basic Information

• Species: Plesiomonas shigelloides
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Plesiomonas; Plesiomonas shigelloides
• CAZyme ID: MGYG000002536_00487
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	MGYG000002536_3|CGC2	73046.4	10.0162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002536	3653255	Isolate	not provided	not provided

• Gene Location: Start: 44299; End: 46221 Strand: +

Full Sequence      

MALRQWIYRACWVSVAGLISIPALAQPTATERQLYQQAKTALDDKQPEVAAGLLPSLKNY
PLYPYLEYRLLTQDMSQLSAAQVRAFVQRYPTMPLAKGLTDRFQAELANRQDWRQLLTFT
PTPPTSIAGQCRYYYARYATGERKIAWQGAHEIWLTGKSLPDACDDLIAAWQTSNQYTPM
AILERMLLAMKAGNSSLLSYLGRQLPANYQTMGKGLLSLQANPDTILTFARTHGASPIAR
QATLIAFNRVVRADVDNARLLISPLSKAQAMSQEQVAQMERAVANRMMDADDSEQIRWRD
AVIRRSGDKSLIEKRIRLALQHNDITDVGEWIARLPASAREQDEWLYWQARVLERKGQKK
QAQALLKTLSERRGFYPMVAAQQLGQPYVVKNDSRQVKVLNAGNWPEVQRIRELMYWDQH
NLARSEWISLIDHQPQTVKAELTRYAQKQGWSDLSVQGTIRGKLWDHLDERFPLAYPNQF
RQSTDDKAISMSYAMAIARQESAWNPQAQSPVGARGLMQLMPKTAQHTAKKNGISLTQDN
QLFLPRVNIQLGTAYLEEVYQKFGRNRILSTAAYNAGPSRVTRWLNNAGGRLDALAFIES
IPFTETRGYVKNVLAYDVFYRYQMKNQADVLTEAEWSRRY

Enzyme Prediction     

No EC number prediction in MGYG000002536_00487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	483	617	1.1e-29	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	4	640	10	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	3.93e-68	471	623	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	8.18e-43	495	616	23	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.63e-39	343	621	1	284	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	5.96e-34	495	616	5	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWK97587.1	0.0	1	640	1	640
QWK94966.1	0.0	1	640	1	640
QOH80246.1	0.0	1	640	1	640
QIY09492.1	0.0	1	640	1	640
SBT60094.1	0.0	1	640	1	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	3.74e-227	31	640	6	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	1.22e-225	31	640	6	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	1.44e-86	3	640	1	638	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	3.59e-86	31	640	1	609	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.06e-85	31	640	1	609	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	9.11e-227	6	640	9	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	9.11e-227	6	640	9	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	6.36e-222	4	640	5	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	1.71e-79	222	640	175	593	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	2.30e-14	481	613	65	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003427	0.994294	0.000955	0.000472	0.000417	0.000387

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002536_00487.