CAZyme Information: MGYG000002536_00495

Basic Information

• Species: Plesiomonas shigelloides
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Plesiomonas; Plesiomonas shigelloides
• CAZyme ID: MGYG000002536_00495
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		56315.08	10.4104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002536	3653255	Isolate	not provided	not provided

• Gene Location: Start: 51734; End: 53251 Strand: -

Full Sequence      

MKARALIFASVLLAGCQAPNHASTPYPSTQESSVRDDADPSSSRWADEQLAQQNVWDFIG
NELKLDVPNNERIRSQKSRYLRNKSHLQRVAERSEPYLYWIVEEVKKRNMPMEVALLPMV
ESAFDPNALSSANAAGLWQITPATGRRFGLDQNWWYDGRRDVGASTRAALDLLQRLNTMF
DGDWMMTLAAYNAGEGRIQKAIKANRAHGKPTDYWSLNLPRETALYVPKVLALSEIIRNA
DRYALNLPHIDKSTALARVNVGQQFDLNTAAQVVGMSVSELQTLNPAYKTLATAPTGPHY
LMLPKQKAKQFKKILRENGDDLTVRVVRHKVQAGESLDVLARRYEISALDIKQINELNGA
GIRRGQYILLPLSQSEYLAKNNRSGTRSSAQSGDDSRIAKNSVTSSYKVKSGDTLSTIAR
RHNMSSSELAKLNRISVSSRLKLGQTLKLKGDAPTEIAYRARKGDSLYSIAQRHGVAVDD
LVRWNDLSRKSVLKPGTVLTVKVKS

Enzyme Prediction     

No EC number prediction in MGYG000002536_00495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	97	241	3.3e-24	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	0.0	1	504	1	449	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	3.19e-62	105	235	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	9.79e-32	100	210	1	111	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	3.61e-21	119	232	9	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.37e-20	96	232	5	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SBT60102.1	0.0	1	505	1	505
QWK94974.1	0.0	1	505	1	505
QWK97595.1	0.0	1	505	1	505
AVQ87235.1	0.0	1	505	1	505
QOH80254.1	0.0	1	505	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E0G_A	3.12e-09	457	504	3	48	LYSMDomain from E.coli MLTD [Escherichia coli]
6FBT_A	1.30e-06	101	236	453	591	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.33e-06	101	236	482	620	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	2.98e-06	101	236	453	591	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	2.99e-06	101	236	454	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	8.08e-128	1	505	1	446	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	8.08e-128	1	505	1	446	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P32820	2.87e-34	93	211	21	139	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31852	8.99e-11	330	505	30	204	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P54421	5.96e-10	330	502	29	193	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002536_00495.