CAZyme Information: MGYG000002536_00831

Basic Information

• Species: Plesiomonas shigelloides
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Plesiomonas; Plesiomonas shigelloides
• CAZyme ID: MGYG000002536_00831
• CAZy Family: CBM73
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	MGYG000002536_6|CGC1	32300.26	6.7031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002536	3653255	Isolate	not provided	not provided

• Gene Location: Start: 85002; End: 85868 Strand: -

Full Sequence      

MRRAAPRVSLPISLASLIIAISVAPISQAATEQERSRQAAEIARQLLCASQNSLKECLDV
NQILTNPSYDDGQWHGDNGQWDQNNSWENSPWENSPSQNNGQWEGNNGTSNQNGQWQQNQ
DGYPRTIRISRLQRHYPLRNQQALIQFEVAAAATYLVNAELYNRDGNRVASAQAQATRQR
TPMTLVVNNPGTYRLEIQANNGLGAQNYTVSVTGRNGINPDEQSSTQPSDYPEYQTGTPY
QAGDVVRRNGRLYQCRPWPNSGWCGQGELHYAPGTGMNWQDAWQYFRG

Enzyme Prediction     

No EC number prediction in MGYG000002536_00831.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM73	234	284	2e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	4.16e-21	129	283	315	474	N-acetylglucosamine-binding protein GbpA.
cd12214	ChiA1_BD	5.08e-05	233	264	1	34	chitin-binding domain of Chi A1-like proteins. This group contains proteins related to the chitin binding domain of chitinase A1 (ChiA1) of Bacillus circulans WL-12. Glycosidase ChiA1 hydrolyzes chitin and is comprised of several domains: the C-terminal chitin binding domain, an N-terminal and catalytic domain, and 2 fibronectin type III-like domains. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. Bacillus circulans WL-12 ChiA1 facilitates invasion of fungal cell walls. The ChiAi chitin binding domain is required for the specific recognition of insoluble chitin. although topologically and structurally related, ChiA1 lacks the characteristic aromatic residues of Erwinia chrysanthemi endoglucanase Z (CBD(EGZ)).
smart00495	ChtBD3	0.002	231	264	1	33	Chitin-binding domain type 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWK98077.1	2.67e-192	1	288	1	288
SBT60697.1	2.19e-191	1	288	1	288
QWK95453.1	7.33e-190	1	288	1	288
QOH80762.1	4.69e-178	1	288	1	283
AVQ86705.1	1.34e-177	1	288	1	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z41_A	5.18e-06	232	287	7	58	ChainA, Carbohydrate binding protein, putative, cpb33A [Cellvibrio japonicus Ueda107]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02I11	9.05e-13	230	283	334	386	Chitin-binding protein CbpD OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=cpbD PE=1 SV=1
Q9I589	9.05e-13	230	283	334	386	Chitin-binding protein CbpD OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cbpD PE=1 SV=1
Q8EHY2	5.90e-08	127	283	314	472	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
A5F0H4	1.07e-07	126	283	319	482	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=gbpA PE=3 SV=1
C3LW75	1.07e-07	126	283	319	482	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.999057	0.000170	0.000180	0.000150	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002536_00831.