CAZyme Information: MGYG000002536_02885

Basic Information

• Species: Plesiomonas shigelloides
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Plesiomonas; Plesiomonas shigelloides
• CAZyme ID: MGYG000002536_02885
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		49779.6	10.0001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002536	3653255	Isolate	not provided	not provided

• Gene Location: Start: 117132; End: 118448 Strand: -

Full Sequence      

MLHDSWMLLHYSVGMLLNNHVLWMVLFPGLIIVELPLYLLVFTGIFRWAYNQPQHTVNQY
PSVSIVITCYGEGDAIGVTIDTLAEQLYPGNIEILAVVDGAVQNKATYLAALHGERKYKG
LKNRKVRVVPKWQRGGRVSTLNAGLSVATGDIIMNVDGDTSFDNDMVMTMVSEFSSANVI
ASGGALRVRNHHKNILTKMQALEYMLSMQAGKTGMANWGVLNNISGAFGAFRKQVLSRVG
GWDTHTAEDLDLTMRLKQYKRRYPKHKLTFATHAIGHTDVPDTLKGLILQRLRWDGDLLF
LYLRKHNKGLSPSLLGWGNFIFILVYGILQNVLLPFLVIVFSVYLVFSYPIQSVLALCML
LYFVYLFFSLLLFTVYIGLVSERKSADIRMAKWIFAYPIYQFLMRMVTAFAMINEIVRRS
HEESSMAPWWVLKKGKKF

Enzyme Prediction     

No EC number prediction in MGYG000002536_02885.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	61	294	2.5e-20	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	8.94e-49	65	249	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.63e-40	22	417	14	412	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.82e-35	47	419	39	404	N-glycosyltransferase; Provisional
PRK14583	hmsR	1.87e-23	7	424	21	434	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd02525	Succinoglycan_BP_ExoA	2.45e-20	62	311	1	239	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOH81441.1	6.32e-310	1	438	1	438
QIY10364.1	6.32e-310	1	438	1	438
QOV31673.1	2.97e-246	1	438	1	438
AWB03045.1	1.35e-245	1	438	4	441
AVF61393.1	1.35e-245	1	438	4	441

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GLC5	1.27e-21	59	294	45	267	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	2.33e-21	59	294	45	267	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8NUI7	3.16e-21	42	294	27	267	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q6G608	3.16e-21	42	294	27	267	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q9RQP9	1.06e-20	42	294	27	267	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
309	328
332	351
358	380
395	417