CAZyme Information: MGYG000002537_00450

Basic Information

• Species: Kocuria rhizophila
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Kocuria; Kocuria rhizophila
• CAZyme ID: MGYG000002537_00450
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000002537_3|CGC1	90998.49	6.2961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002537	2636961	Isolate	India	Asia

• Gene Location: Start: 88106; End: 90541 Strand: +

Full Sequence      

MVPLDPVDFPRQLSDEHLDLVFVESAWSGNGGQWHRGVGHYSNEEHAPLRDLLARCRAEG
IPSVFWNKEDPVHIERFRVTGALCDHVFTTDADMIPAYLHEARHLEGAGAVTASSLPFYA
QPAIHNPLPGRRPVEETVAYAGTYYGDRYPDRKRQLDNLLGAAAPHGLAIYDRQLAVPDS
PYRFPGQYERAVRGALPYDEVIDSYRAHAVNLNVNSVATSPTMFSRRVVEIAACGGVVLS
TWSRGIHETFGSAIPSSNDELQRAALLTAWTSNPEERLREVWLQLRTVLRSHTVETALVV
LARTAGLVVDGFQLPAWGATARPAQVPAILKQSVRPVAVHLVEDDAAARRSLESHGIRVT
SGVQDRPSVDFWAHLPEAAGRTWAEDLLQATRWGHWDKISAHEPGLGQGSRHVAVPGENV
VDEFGMARSALLPMENPQDFRELVTPLTLTVTRPREEASEPLHSVRCSDSDGREQQPRVL
VAGHDLKFAASWIEHLRERGVPVLVDMWNDHAHHDEQESLVLLGQADTVFCEWGLGNAVW
YSQHVSDGQRLVVRVHAQEIRGPYLKRIQHGRVSSYLFVSELVKEAAITSHGLPREKCHV
VPNIVQCERLRQDKLPGARKTIGFVGLVPQLKRLDRAVDLIEELVRFDPEFRLLIKGKRP
EEYSWMLKRDEELAWYHQCYERIDRLNARQQSEVVRFEAHGDDMAQWYRNVGYGVSVSDH
ESFHLTLPDAAASGAAPVSLDWPGADLIYPREWLVSSVSQMARRIFDLSRDEAQRTQFIG
RAGRFVQEAFDESLVHSALDAAARVKESDLP

Enzyme Prediction     

No EC number prediction in MGYG000002537_00450.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.90e-19	478	791	35	353	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03819	GT4_WavL-like	1.27e-13	579	790	133	342	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03811	GT4_GT28_WabH-like	4.45e-13	548	745	105	297	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG4641	COG4641	1.29e-12	51	295	97	349	Spore maturation protein CgeB [Cell cycle control, cell division, chromosome partitioning].
COG0438	RfaB	1.43e-10	533	791	96	362	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ21497.1	0.0	1	802	667	1468
QIR69757.1	0.0	1	802	667	1468
VEI50390.1	9.89e-309	1	801	437	1248
ADU47661.1	1.64e-254	1	771	513	1285
QNN82256.1	1.66e-254	2	802	533	1333

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002537_00450.