CAZyme Information: MGYG000002538_04310

Basic Information

• Species: Klebsiella pneumoniae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella pneumoniae
• CAZyme ID: MGYG000002538_04310
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189	MGYG000002538_1|CGC57	21294.63	10.329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002538	5484149	Isolate	United States	North America

• Gene Location: Start: 4513725; End: 4514294 Strand: -

Full Sequence      

MVARRVLMFLLLFPPLACAQSIPSGYRQIAEQENVPAEALYSLALTESAKKLAHGVRPWP
WTINVAGIGYRYASRDEAYQALLGFIRRYPLKRIDVGVAQVNLGWNGSRFSSYWHAFDPY
TNLRVAARILRECYDAQPGSWMQAAGCYHHPAGGKPARVYKAVVQRHLNTLNPVKPTAVS
WVEPKRKTP

Enzyme Prediction     

No EC number prediction in MGYG000002538_04310.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	3.86e-11	34	169	2	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16892	LT_VirB1-like	1.99e-09	34	148	8	121	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	0.002	117	166	47	92	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU34046.1	1.01e-140	1	189	1	189
QHP40271.1	1.01e-140	1	189	1	189
AKK87132.1	1.01e-140	1	189	1	189
AWJ11791.1	1.01e-140	1	189	1	189
AOD05123.1	1.01e-140	1	189	1	189

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002977	0.994677	0.001301	0.000465	0.000277	0.000254

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002538_04310.