CAZyme Information: MGYG000002539_01886

Basic Information

• Species: Collinsella aerofaciens_A
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella aerofaciens_A
• CAZyme ID: MGYG000002539_01886
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000002539_1|CGC22	78991.84	4.901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002539	2306349	Isolate	India	Asia

• Gene Location: Start: 2165496; End: 2167661 Strand: +

Full Sequence      

MSGKEQLFEVSLEREGAYRSISAALEAAERCVPDATVPVRVLVAPGEYREQVEIRRPHVT
LEGETADSVRIVGGLGAKMPSEDGSGQDGRLGTFRTYTVLVDADDVTLAGLTIENDAGDG
REVGQAIALYADGDRLVVDTCRILGHQDTLFLGPLPPHEAKPGGFIGPKQFAPRRVGRQY
FRRCRIEGDVDFIFGGAHAYFEGCEIRSLNRDMDVNGYVTAASTPQGEPYGFVFHGCSFT
ADEGIAPGSVYLGRPWREWAQTVLLECWLGPHISLEGWWDWNKPAAHDGTLYAGGALFGP
AGDTAAWVPWAHCLTGQDSERYARDRVLAGTDGWDPEGGDGDAVETAGLSANGRTVHIET
YYEDEPALRARLKREGRSAAFTGKTPTDFEVWKAATRTRLYDILGLSLMDRAPIEIRELN
RVRVAGSIVRTHAVLQVEHDVWMPFYLLEPSRPKLDERGLKRCYICPHGHQGAGAASIAG
VVGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLETRGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPRPLLVQSCEKDHLN
GARGLANVDEQLDIVRDAYALLGKDENLLHEVCPGGHHLGVAHLAEDIEWLDSQVAECAH
A

Enzyme Prediction     

No EC number prediction in MGYG000002539_01886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	328	1.4e-78	0.9791666666666666
CE19	457	698	4.7e-26	0.5993975903614458

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.65e-64	18	330	94	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.68e-49	16	311	10	275	Pectinesterase.
PLN02773	PLN02773	1.06e-41	10	322	9	290	pectinesterase
PLN02708	PLN02708	4.09e-41	16	336	251	550	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	9.13e-41	7	319	12	277	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54718.1	0.0	1	721	1	721
QIA34433.1	0.0	1	719	1	719
QUC03567.1	0.0	9	717	8	711
QRP39805.1	8.93e-105	10	336	20	349
ASN95501.1	8.93e-105	10	336	20	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	1.66e-25	18	288	44	310	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1XG2_A	2.48e-25	10	315	7	284	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.64e-23	15	278	16	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.01e-23	15	278	16	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.14e-22	18	288	18	286	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	5.08e-36	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	4.52e-29	6	322	5	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43043	7.23e-29	10	334	61	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q9FM79	1.46e-28	22	334	92	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q43062	2.08e-28	10	310	211	482	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002539_01886.