CAZyme Information: MGYG000002540_01408

Basic Information

• Species: Paraprevotella clara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella clara
• CAZyme ID: MGYG000002540_01408
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671	MGYG000002540_22|CGC3	77603.15	6.0974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002540	4187245	Isolate	not provided	not provided

• Gene Location: Start: 151873; End: 153888 Strand: -

Full Sequence      

MAQKIMLSLAVFFCWTFALKAEEYKLSSPDKRLEVKLRVEGRTEFEVWYDKVKLVEPSVI
GMNLSDGRHVGGDPVTSVKKDRVNRKIDVVAGKNKTLKEAYNEIVLSYGTDYDLVVRAYN
EGWAYRFVTHWDKEIIIDSEDAVFNFAFTPTVYFPECDSNTAPEREQSGKVHQIHQGYRN
FERLYKVYRSPGEIPAGRFSVSPVLFEYPGKPYKVVVTESDTYDYPGLYMEAAGQNSMRG
KWAAYPKEVMDGDPSNPYRWYSNHLVISREDYIARTGGDRTFPWRVMIVSDDDKTLLNNE
LVYMLAEPCKIEDTSWIQPGKSAWEWWHKAVVEGVDFPVGNKHLSLQLYKYYVDWASENG
IEYMTLDAGWKMEYIKELCDYARGKNVKILVWTWASCPLENPNDWIKQMHECGVAGAKID
FFERNDQIAMRWGREFAERLAQYRMVAIFHGCPVPVGLNRTYPNVMNYEAVRGAECNFWE
KTITPEYHTRFPFIRSLAGPEDYTPGGMRNVTPEEFQPRDRDSIPPMNMGTRSHVLSMYV
IFDHWIGYLCDAPSEYNKYPDILDYLSKVPSVWDKTLPLDARLGEYIVMAKQTGKDWYVG
GMTNWTPRSVTVDFGFLKRGKTYRAVVFKDKPESGDHPTTYACETMNVDRNTKLTLDMAR
GGGFAIRLTEE

Enzyme Prediction     

No EC number prediction in MGYG000002540_01408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	12	668	1e-173	0.993660855784469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	3.40e-98	313	570	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.10e-54	28	308	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	2.54e-42	573	669	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73254.1	0.0	7	671	9	673
QUT41086.1	0.0	7	671	9	673
BCA52479.1	0.0	7	671	9	673
ALJ44649.1	0.0	7	671	9	673
AAO78269.1	0.0	7	671	9	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	1.10e-131	28	668	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.82e-130	28	668	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3WFA_A	6.01e-43	23	670	2	705	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2D73_A	6.56e-43	23	670	22	725	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]
2JKA_A	8.17e-43	25	670	13	714	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	1.28e-132	16	668	14	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	1.36e-46	27	601	44	561	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	3.46e-45	1	670	1	725	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000377	0.998899	0.000224	0.000160	0.000151	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002540_01408.