CAZyme Information: MGYG000002540_01869

Basic Information

• Species: Paraprevotella clara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella clara
• CAZyme ID: MGYG000002540_01869
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786		88863.38	5.3917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002540	4187245	Isolate	not provided	not provided

• Gene Location: Start: 171625; End: 173985 Strand: +

Full Sequence      

MNVLRSLCSASLLLVWVSANARIPVKVETFPLNDVRLTQSPFKHAEDLDVRYLLGLDPDR
LLAPYLKGAGLEPKADNYTNWENTGLDGHIGGHYVSALSYMYAATGDEEIKQRLDYMLSE
LKRAQDAAGDGYLCGAPNGRKIWEAVSKGDIQASSFGLNGGWVPLYNIHKTYAGLRDAYL
LAGSKEARDMLVKLTDWMMNLTKDLSDEQIQDMLRSEHGGLNEVFADVADLTGKDNYLQL
ARRFSHREILDPLLEHEDRLTGKHANTQIPKVIGYKRIADLQGDEGWDDAARFFWETVVE
RRSISIGGNSVREHFHPSEDFSSMLTSEQGPETCNTYNMLRLTKMLYQTSADVHYMDYYE
RALYNHILSTIDPVQGGFVYFTPMRSGHYRVYSQPQTSFWCCVGSGMENHAKYGEMIYGH
SEDELYVNLFIPSVLQWGKVRVEQLTGFPYEEATTLHLSCGKAKEFTVKFRVPEWTDVSQ
MELTVNGTAQPVSVSGGYVTVSRKWADGDEVRLTLPMSLRVAALPDGSDNYSFMYGPIVL
ASRMGKQEQVGLFADDSRGGHVASGPQWPLQDMPVIVGDKDDLLSHIEKVEGKPLEFKLR
GVYPERYEGMTLEPFNCLYECRYMVYWPVISPDKLKAQQEALARSEREKNELEAATADKV
ICGEQQPESDHFIRSEQSRNGSHNDRHWRDATGKGWFSYRMKTNGRDVSRLRVEYEGGMA
DTDALVMVEERTVGMLSPVDGRGMKTAYFDLPDEMDGKDVLTVKITPSEKKATPRVYEVR
LMTAKK

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	34	541	1.2e-212	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	34	541	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.02e-131	26	548	8	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.97e-42	545	627	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
cd04434	LanC_like	0.006	97	243	10	185	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK86774.1	0.0	1	783	1	782
AND18452.1	0.0	1	783	1	782
ABR38200.1	0.0	1	782	1	781
QQY39509.1	0.0	1	782	1	781
QQY42772.1	0.0	1	783	1	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.72e-287	26	782	24	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	6.54e-277	26	782	24	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	9.16e-24	95	521	76	521	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000478	0.998744	0.000259	0.000185	0.000159	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002540_01869.