CAZyme Information: MGYG000002541_01712

Basic Information

• Species: Cardiobacterium valvarum
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Cardiobacteriales; Cardiobacteriaceae; Cardiobacterium; Cardiobacterium valvarum
• CAZyme ID: MGYG000002541_01712
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622		69166.78	7.239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002541	2547857	Isolate	not provided	not provided

• Gene Location: Start: 944; End: 2812 Strand: -

Full Sequence      

MHKVLLTLILSLGSLTGSNAENILDAENAIKNGAPLAAYQHLAPHPLYPYLQARAYRDDP
ATPVETIVAFLKQYPADPFSTQLAKQKFPLWLASGNNDAIIAAYSADYADAGIECDYRLA
QLNKNHTRAATQKLDELWEQDKNLDAECNTLFDRLAHGGHISETQTAARFRQAMDKNNRL
IASYLAGGLHGAAAQAAQTWLDIDQGNLPLDAAYNLAPDWRSALLAQQLGKRLKKDPSAI
AQAANAAAFGYLSNPKDAGKLYNPLLRKLADNDDPHTLTIWNAIPAGEHEDNTIYDLIAY
DLRRSDWRGLASHLGKLGPEAQDKAEIQYWLGKALEKNGDRAGADTHYRRAATQRDFYGF
LAAEKLGETFRLNDRPVRRDQHYTTIVGRPAAYRARIFRNLGDDARASQEWQAFTKNLSP
AENAQAALYASEIGWNIQAITTLGKGKNWDALELRFPVAYENQVRQLASRHGISPAQILA
IIRKESIFQPGIASKAGAIGLMQVMPATASHTAQKNGIPYSGKWQLTEPDTNLEIGSQYL
ADRLNEFGHLAYAAAAYNAGPSRVRQWQAQFAGLPLDEWIAQIPFNETRDYVKRVLEYEK
VYEYRLGLLSYTLHDNGAVRLW

Enzyme Prediction     

No EC number prediction in MGYG000002541_01712.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	472	601	2.3e-30	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	5.13e-75	42	616	59	638	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	1.25e-57	455	605	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.17e-35	457	601	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	9.30e-29	329	607	5	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	1.23e-22	475	598	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG78123.1	0.0	1	622	1	622
AXM45501.1	3.86e-180	15	622	13	621
ABQ13599.1	1.09e-179	15	622	13	621
AFL76346.1	6.90e-85	3	622	20	650
AUB81462.1	1.04e-83	26	615	62	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	9.03e-65	42	607	32	603	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	2.38e-63	42	607	32	603	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	1.29e-60	8	607	12	626	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	1.40e-60	32	607	16	597	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	3.91e-60	32	607	16	597	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	8.21e-64	42	607	59	630	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	8.21e-64	42	607	59	630	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	2.19e-63	42	616	59	639	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	5.50e-36	302	603	273	573	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	6.47e-17	461	595	61	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000493	0.998602	0.000332	0.000196	0.000179	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002541_01712.