CAZyme Information: MGYG000002541_01851

Basic Information

• Species: Cardiobacterium valvarum
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Cardiobacteriales; Cardiobacteriaceae; Cardiobacterium; Cardiobacterium valvarum
• CAZyme ID: MGYG000002541_01851
• CAZy Family: GT2
• CAZyme Description: Galactofuranosyltransferase GlfT2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	MGYG000002541_126|CGC1	68579.4	7.3976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002541	2547857	Isolate	not provided	not provided

• Gene Location: Start: 53781; End: 55583 Strand: +

Full Sequence      

MNILQNFIFPDYNPLAPADMYFRGDDAGVFLRNESCLQCKKYGQYTFDTYFNGFMLDAWS
GRAKIDSLHATLHGKGAFQIQFILVRHSDYALTEKAENHTRRIILTQHVTLTESGVSFPL
DSALAWQDGMLYLAITALEEDALFYGGAYWTDTAPRNPVKLGMVITHFNRKNYILPAIAR
ISRHILGNPQWADKIALIVVDNSQNISAEEAGLAHVIPNQNLGGSGGFTRGLLYLQDAGD
FTHCLFMDDDASCEIESILRSYVLLQYIQESRFAIAGALLQENFPSILHEKGAVYRHTLN
HGLHRGLDIREKANVIASEISEMAANFGAWWFFAFNIRDVEVYPYPFFVRGDDILFGISN
RFNILTLSGIACWGDDFAIKENPLTRYLGLRSTLVCSMLLGDVSWPHLSLTCLRWFAASA
LSHNYASAEALLLALDDVCQGPDTFLQDMSAAKVREKIAPLTAQEKMTPVRHEDIGAQFV
GMHESRWRKLCRLLTLNGLLLPSFLLKDDTVWQRKGFRASFREIFRFKRVYYEYESGHVG
YLAHYDRKRFFALLFRLLGRLLRNAPRYRQLRQEYRTRFPAMTSRTFWQTVYADDDKTQG

Enzyme Prediction     

No EC number prediction in MGYG000002541_01851.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	2.68e-06	160	358	4	200	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13641	Glyco_tranf_2_3	2.28e-05	158	389	1	229	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd02526	GT2_RfbF_like	3.47e-05	164	276	2	113	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04185	GT_2_like_b	0.001	164	251	2	90	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	0.010	164	266	2	103	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUX60573.1	1.01e-172	1	597	1	592
QIP47313.1	1.09e-163	1	592	1	588
ASC06508.1	1.36e-157	3	599	17	604
BAI09032.1	1.92e-157	3	599	17	604
QHM92243.1	1.92e-157	3	599	17	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FIX_A	1.24e-15	37	591	66	645	CrystalStructure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIX_B Crystal Structure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIY_A Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv],4FIY_B Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R628	9.46e-16	44	591	64	635	Galactofuranosyltransferase GlfT2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT2 PE=3 SV=1
O53585	6.60e-15	37	591	46	625	Galactofuranosyltransferase GlfT2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002541_01851.