CAZyme Information: MGYG000002541_02109

Basic Information

• Species: Cardiobacterium valvarum
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Cardiobacteriales; Cardiobacteriaceae; Cardiobacterium; Cardiobacterium valvarum
• CAZyme ID: MGYG000002541_02109
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		34440	6.0769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002541	2547857	Isolate	not provided	not provided

• Gene Location: Start: 51602; End: 52525 Strand: +

Full Sequence      

MARQRSIREPIAGSGIGVHSGRRVDIRLLPAPADSGIRFRRTDLDPVVELPARADLVRDT
QLCTALANEDGVRVATIEHLMSALAGLGIDNLTIELNAPEVPIMDGSAAPFVYLLQQAGI
RELDALKTFIHISDTIEVREGDKWARLSPHNGCCFDFTIEFDHPVFRHRNNHTRLDFTSR
RYIRDISRARTFGFLRDIEYLQSHGLTLGGGLDNAVVVDDYRVLNEHGLRFDDEFVRHKL
LDAVGDLYLLGAPLIGHYQGYKSGHDLNNKLCLALLTSPQSWQRIQLDRDSDIQIDYGEN
LPLPQAS

Enzyme Prediction     

No EC number prediction in MGYG000002541_02109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	4	276	6.9e-111	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13186	lpxC	6.37e-176	1	291	1	288	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
pfam03331	LpxC	8.17e-164	4	276	1	270	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
COG0774	LpxC	1.47e-159	1	285	1	285	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	7.99e-132	3	283	2	279	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK13188	PRK13188	6.41e-86	1	271	2	294	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG78206.1	8.10e-192	1	306	1	306
ABQ13315.1	2.55e-135	3	291	2	289
AXM45761.1	2.55e-135	3	291	2	289
QBY44619.1	1.67e-125	1	297	1	297
CBA74798.1	1.67e-125	1	297	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDT_A	2.86e-125	1	297	1	297	Structureof LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_B Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_C Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_D Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli]
3P3G_A	3.42e-125	1	297	1	297	CrystalStructure of the Escherichia coli LpxC/LPC-009 complex [Escherichia coli IHE3034],3PS1_A Crystal structure of the Escherichia Coli LPXC/LPC-011 complex [Escherichia coli IHE3034],3PS2_A Crystal structure of the Escherichia Coli LPXC/LPC-012 complex [Escherichia coli IHE3034],3PS3_A Crystal structure of the Escherichia Coli LPXC/LPC-053 complex [Escherichia coli IHE3034],4IS9_A Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4IS9_B Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4ISA_A Crystal Structure of the Escherichia coli LpxC/BB-78485 complex [Escherichia coli IHE3034]
3NZK_A	3.52e-125	1	297	6	302	Structureof LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor [Yersinia enterocolitica],3NZK_B Structure of LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor [Yersinia enterocolitica]
4MQY_A	4.06e-125	1	297	1	297	CrystalStructure of the Escherichia coli LpxC/LPC-138 complex [Escherichia coli]
2VES_A	1.40e-114	1	297	1	296	CrystalStructure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_B Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_C Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],3P3E_A Crystal Structure of the PSEUDOMONAS AERUGINOSA LpxC/LPC-009 complex [Pseudomonas aeruginosa],3U1Y_A Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3U1Y_B Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3UHM_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase in complex with inhibitor [Pseudomonas aeruginosa],4LCF_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-014 complex [Pseudomonas aeruginosa PAO1],4LCG_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-050 complex [Pseudomonas aeruginosa PAO1],4LCH_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-051 complex [Pseudomonas aeruginosa PAO1],4OKG_A LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],4OKG_B LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],5DRQ_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-040 complex [Pseudomonas aeruginosa PAO1],5DRR_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-058 complex [Pseudomonas aeruginosa PAO1],6I46_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I47_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I48_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_BBB Chain BBB, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I4A_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],7CI4_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI4_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_C Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_D Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI7_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI9_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIA_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIB_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CID_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7DEL_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEM_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEN_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KPW7	5.88e-125	1	292	1	293	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=lpxC PE=3 SV=1
P0A727	2.22e-124	1	297	1	297	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=lpxC PE=3 SV=1
P0A728	2.22e-124	1	297	1	297	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Shigella flexneri OX=623 GN=lpxC PE=3 SV=1
P0A726	2.22e-124	1	297	1	297	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=lpxC PE=3 SV=1
P0A725	2.22e-124	1	297	1	297	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=lpxC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999968	0.000070	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002541_02109.