CAZyme Information: MGYG000002541_02379

Basic Information

• Species: Cardiobacterium valvarum
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Cardiobacteriales; Cardiobacteriaceae; Cardiobacterium; Cardiobacterium valvarum
• CAZyme ID: MGYG000002541_02379
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000002541_184|CGC1	29440.9	10.2993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002541	2547857	Isolate	not provided	not provided

• Gene Location: Start: 9097; End: 9921 Strand: +

Full Sequence      

MRTLALCTALLSLPALGAGTAIALIPNYIQETAARYQLSATDLFAGGDAWPWLVWRDNTP
LRLRDQATLIRYLQADPNIPFGLWRLRLADFPIGTPAALASNPRQQAELAARRALAHKQI
APRKAAPVARHAALPAAAAYSGRYQEHINSAATRHGIPSALIAAVIGAESNYVAGAVSPK
GARGLMQVMPGTAASMGYNPDDMFKPSVAIDAGTRYLAIQLNRFKQVDLALAAYNAGPEA
VAKYGNRIPPYRETQDYVKKILNNYRAAMPGVSP

Enzyme Prediction     

No EC number prediction in MGYG000002541_02379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	159	268	5.3e-31	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.71e-41	160	266	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	6.87e-39	143	266	3	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.52e-38	144	265	6	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	3.09e-24	148	247	1	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	6.99e-24	150	267	3	158	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ55223.1	1.24e-33	144	265	114	232
AGC50601.1	1.24e-33	144	265	114	232
BAE80231.1	3.02e-32	148	268	25	147
BAE80262.1	6.00e-32	148	268	25	147
QCX11160.1	2.60e-31	148	268	132	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.16e-11	140	271	408	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.16e-11	140	271	412	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.17e-11	140	271	418	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.17e-11	140	271	422	574	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.18e-11	140	271	428	580	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	2.20e-29	140	269	1418	1545	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.20e-29	140	269	1418	1545	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	1.91e-24	148	267	64	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC3	1.38e-07	157	262	493	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.38e-07	157	262	493	619	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.040860	0.957603	0.000491	0.000477	0.000286	0.000260

TMHMM  Annotations     

start	end
7	29