CAZyme Information: MGYG000002542_01000

Basic Information

• Species: Lentilactobacillus parafarraginis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus parafarraginis
• CAZyme ID: MGYG000002542_01000
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	MGYG000002542_47|CGC4	77366.01	6.7885

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002542	2852137	Isolate	not provided	not provided

• Gene Location: Start: 84740; End: 86752 Strand: +

Full Sequence      

MSGVHQKRGTQVLEFELLDVTSSLEHAYMLFVEKNSLASVMKPITKLLNHNIIRVKINAQ
DFHFEAADQTEFEWQIFLVDNATDQKNVIQVESEYLSDRHQLELTSYYQFNSDAAGMALF
NIRTHQSDQDFMINSVNLTDTDLEITGYNKINGTPIKDQRIILKNRVNDGKLDYPVSQTM
FAGMFKVAIPLTDIPKDSVGELFVEYTLNDRQILQRMIISKSLAGQSVEADLPNNRVITI
EKRFDNGILVKEFQGASLLQKVAAAGGKAHGVLDVCRMVQDKLNLARMRFLFKSGHSPYE
NTTIIFESFGGRQVSDSPYAIYQLFKTLYPGIRMVWSIDRSQKAFCKQNQISYVIRRTNK
WVRVLEKSQFWISNARFPSWVKKPSYVTYIQTWHGTPLKKLGLDIENVSMPGTTTAKYHR
NFVKEANRWDALVSPNDYSTQIFRSAFGFNNQILKIGYPRNDELINTAPDDITAIKNQLG
IPLDKKVVMYAPTYRDNQFAEKGKYTFELPFSLDDFHKSFGEDTVLILRMHYLISNALDI
SDYSDFVYDFSNYPNISDLYLVSDLLITDYSSVFFDYAYLKRPILFYPYDYHLYKEELRG
FYLNYERDLPGKIAHNSEELLAEIHHALGHSDMSANQRFMNFYNRFCAINDGLSSLKVVN
YVMHQIESGV

Enzyme Prediction     

No EC number prediction in MGYG000002542_01000.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.66e-133	298	662	1	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	5.47e-91	288	663	12	385	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTN00810.1	9.69e-112	202	665	290	740
QJE26285.1	7.09e-110	303	667	354	719
QDW93226.1	7.09e-110	303	667	354	719
BBD89239.1	7.09e-110	303	667	354	719
BBD91714.1	7.09e-110	303	667	354	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	2.36e-110	303	667	354	719	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	2.53e-109	303	667	354	719	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	6.99e-109	303	667	354	719	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	1.87e-119	185	662	246	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	1.93e-111	295	663	25	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	1.06e-109	303	667	354	719	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	4.67e-104	304	658	30	383	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P27621	5.95e-36	390	667	122	381	Teichoic acid glycerol-phosphate primase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000092	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002542_01000.