CAZyme Information: MGYG000002542_01263

Basic Information

• Species: Lentilactobacillus parafarraginis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus parafarraginis
• CAZyme ID: MGYG000002542_01263
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495		55759.45	5.1949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002542	2852137	Isolate	not provided	not provided

• Gene Location: Start: 5833; End: 7320 Strand: +

Full Sequence      

MAGQNTFTTFQMKNFRYIELVGLQGTLHPDDINGWAMQQPFNEDESAFTSDNQLLNREYE
MSKYTIKATNQDVFVDSQARERRPYEGDLLVNGLTSFAVSSNYSLDRHSLDYLIDNPTWP
EDYKLFNVEMAWLDYLYTGNRDLLESRYEQLTYKLNRGKSSESFDGASQGFTGSLKNIKG
VDNFDETVGLVTNDGLIDWPIPERDGFIEGKYNTPFNAIFYGAYRMMSQIAKVTGHDQDV
SFYEKRADRIKAELINRLYDAESGRFYDSLNADLTVNQHTSHHASAYALCYGVYSDQLMA
DKLSKFVANQGHFIGSVYFIYFMLKGLIDAGHADDAIALLTNPDDRKDQKTFAAILNTLK
ATIAPEAWSNHYKPNMTLSHPWGATPGLTIVQGIMGINPIEPGFNTFRIKVRPGNLKKLQ
VTTPSPKGLIKVAYQRNGLQAELVAEVPMNAQAELVLPEEATDIQITGTTNQLAANNNST
INLASGKYRISYHQN

Enzyme Prediction     

No EC number prediction in MGYG000002542_01263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	9	457	1e-91	0.8531746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.75e-27	43	387	1	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.18e-11	396	464	1	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOP51644.1	4.21e-267	1	495	393	890
QOJ86162.1	5.96e-267	1	495	393	890
APR07480.1	7.63e-267	1	495	411	908
AFS01190.1	7.58e-262	1	495	411	908
AEB74357.1	1.07e-261	1	495	411	908

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	8.04e-13	3	459	493	943	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	2.87e-12	5	432	263	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	2.28e-69	15	459	700	1138	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002542_01263.