CAZyme Information: MGYG000002542_02886

Basic Information

• Species: Lentilactobacillus parafarraginis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus parafarraginis
• CAZyme ID: MGYG000002542_02886
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000002542_211|CGC1	74449.38	4.8614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002542	2852137	Isolate	not provided	not provided

• Gene Location: Start: 119114; End: 121087 Strand: +

Full Sequence      

MDELTKLSVNDVQITSTFWKRYRDLIAEESVPFQWDMINDKGKMDVTNAAAAGGAADHSG
AIENLKIAAGRAEGHHFGYPFQDTDVYKWLQTVAYVLKYHFDPKMKEEADWTVDLIADAQ
DDDGYLSTYFQIDAPQRKFKRLQQSHELYSMGHYIEAGVAYYESTGNQKALDIAEKMAGC
INNHFGPEDGKIHGYDGHPEIELALAKLYETTKNKTYLNLAKYFITERGQDLHFFDRQNK
ADGIDNDFFPELRTIGDRYYFADKPITEQKDAHGHAVRVLYFCTGLAHVARVEHDDKLLK
AANTIWNDIVKKQMYITGNVGQTATGEAFTYDYDLPNDTDYGETCASVSMAFFTKQMLAN
EFNGQFGDIIEKEIFNGALSGIALDGKHYFYANPLEADPLASKLNPGKKHIALRRSSWFA
CACCPANITRLIASLDQYLYEIHDDVILSHQFIANDAKFNDGIEIKQTGNFPWDGNIDYA
ITNPNTSKFTFGIRIPAWSLDNYSIKVNGKEVEPDLKENVLYIPINDKTTAISLELNMNV
HVVRANANVSADIMKVAVQRGPIVYCLEGVDNEEPLSRYVLGQKPSFDYNYQSKLLNGVG
VVTTDDAYRIADDSDDSLYTFDRPKGVEKAHLEFIPYYAWANRDEKQMTVWLHQSEI

Enzyme Prediction     

No EC number prediction in MGYG000002542_02886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	12	566	1.4e-197	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	3.72e-162	2	652	7	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	4.96e-148	11	566	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04792	LanM-like	0.007	159	222	602	677	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGV24837.1	0.0	1	651	1	650
QGV24955.1	6.20e-294	5	654	8	662
QHB51374.1	6.22e-285	1	654	1	655
QHB50844.1	1.25e-284	1	654	1	655
ATF41724.1	1.02e-283	7	654	7	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WRE_A	3.73e-216	11	650	2	654	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	3.82e-216	11	655	2	659	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	1.09e-215	11	655	2	659	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRF_A	2.36e-209	11	644	2	648	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217]
4QJY_A	9.01e-180	6	655	11	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.04e-215	11	650	2	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002542_02886.