CAZyme Information: MGYG000002543_00449

Basic Information

• Species: Campylobacter_B ureolyticus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_B; Campylobacter_B ureolyticus
• CAZyme ID: MGYG000002543_00449
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000002543_4|CGC1	39189.23	9.6072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002543	1665696	Isolate	Ireland	Europe

• Gene Location: Start: 63497; End: 64537 Strand: +

Full Sequence      

MKILVSSLEPSANLHLGCILKNLENYELKGIFDPKFGKPLLASSEFSAMGFVEVLPLIFK
AKRAIKEMVKLAKECDMVLLIDSPAFNLPLAKALKKEGVKAKITYYILPQVWAWKKKRVK
KVEAFCDNLASILPFDEKFYSKSTFVGHPLLDQIKSFKDDYTPKKTISFLPGSRKAEIKR
LMPIFRELVCKFDDDFTKILVTPPGLKDDEIYGDTSGFVISTNTHESLQKSDFAFICSGT
ATLESALIGTPFVLCYKAREIDFFIAKNFVKIKHIGLANIFYDFMGKAELHKELLQGDVT
ALNLYKAYLECDINKFKEAKNELKKYLKFGSAKNVAQILRTSIIDK

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	326	3.1e-93	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	0.0	1	339	2	344	lipid-A-disaccharide synthase.
COG0763	LpxB	8.87e-104	1	339	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.14e-88	3	329	1	355	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.75e-82	3	339	8	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	1.01e-76	1	338	2	370	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX86666.1	1.05e-250	1	346	1	346
QKF85036.1	1.59e-243	1	346	1	346
QQY36471.1	1.59e-243	1	346	1	346
AKT91302.1	9.22e-242	1	340	1	340
QOQ87733.1	5.86e-167	2	342	4	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.45e-27	76	309	92	342	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.45e-27	76	309	92	342	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FK76	1.41e-127	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=lpxB PE=3 SV=1
Q5HWH9	1.41e-127	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=lpxB PE=3 SV=1
Q9PIK8	1.32e-125	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=lpxB PE=3 SV=1
B5Z7M7	4.71e-94	3	336	4	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1
B2USW3	1.89e-93	3	336	4	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain Shi470) OX=512562 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002543_00449.