CAZyme Information: MGYG000002545_00009

Basic Information

• Species: Faecalibacterium prausnitzii_G
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_G
• CAZyme ID: MGYG000002545_00009
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		21808.96	5.2788

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002545	2833887	Isolate	Ireland	Europe

• Gene Location: Start: 6616; End: 7191 Strand: +

Full Sequence      

MKTLFRLLRRLVVLVCIAAVLLTVLPPLAREADRLLYPRKYSQQVEQWAAEYELDPLLVY
AFIRTESGFDPAATSSVEARGLMQMTEETFIWLRSKIAPDEGLTFDELYDPDVSIRFGCY
YIHLCMERYGGDVATAAAAYHSGWGTVDNLLRMEEHSSDGQTLKGFPYNQMHHYVEKITA
SYAVYTRLYGG

Enzyme Prediction     

No EC number prediction in MGYG000002545_00009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	53	184	1.2e-27	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.46e-56	38	182	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.35e-35	36	188	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.40e-29	56	183	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.29e-26	47	152	3	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.46e-25	29	191	127	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA80758.1	7.00e-136	1	191	4	194
CBK98413.1	2.74e-133	1	191	4	194
AXB28497.1	1.82e-96	24	191	53	220
ATL89088.1	7.70e-95	13	190	9	186
ATO98725.1	1.27e-93	13	190	9	186

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.44e-11	29	190	399	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.45e-11	29	190	403	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.45e-11	29	190	413	574	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.45e-11	29	190	409	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.46e-11	29	190	419	580	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	7.35e-15	37	183	1418	1542	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	7.35e-15	37	183	1418	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	3.61e-11	45	182	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P27380	1.26e-09	49	143	15	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P0AGC4	4.76e-08	37	191	476	630	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.398925	0.585370	0.010368	0.002273	0.000899	0.002160

TMHMM  Annotations     

start	end
7	29