CAZyme Information: MGYG000002545_01169

Basic Information

• Species: Faecalibacterium prausnitzii_G
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_G
• CAZyme ID: MGYG000002545_01169
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000002545_1|CGC7	84060.39	8.6694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002545	2833887	Isolate	Ireland	Europe

• Gene Location: Start: 1200811; End: 1203033 Strand: -

Full Sequence      

MKPTEEKTRSNPSDLPVYLFKQGNNCEAYRYFGAHIEQRAGETGVVFRVWAPHATAISVV
GDFNSWKPGSHPMRKVDNDSVWELFIPGMKEYDVYKYCVTTRAGDLVYKADPYAFHAETR
PSNGSKVYDLNGFVWHDEAWQNAQKKADVINGPMNIYEMHAGSWKMKEGGLPYNYSELAD
ELIPYITEMGYTHVELLPVMEYPFDGSWGYQVTGYFAPTSRYGTPKDLMAFVDKMHEAGI
GVIMDWVPAHFPKDQFGLYNFDGEACYEDPNPKRGEHKEWGTMVFDFGRSEVQSFLISSA
LYWLEQYHIDGLRVDAVASMLYLDYNRKQGEWEPNKDGGKENLEAVAFLRKLNDTVLGRH
PHKYMIAEESTAWPMVTKPASDGGLGFNFKWNMGWMNDMLSYMKTDPLFRSGNHNKVTFS
FFYAFSENFVLPISHDEVVHGKGSLINKMPGDYEAKFANLRTFFGYMMAHPGKKLLFMGQ
EFGQFTEWNETKSLDWMLLGYDKHTELQTYVKTLNKFYKDHPAFWQIDYSWEGFQWIVPD
DSRQSVVAFLRKDANGKQILVVCNFNPVLREGYTLGAPNSGTYKEILNSDDEAFGGAGTV
HNKAVRSKKKPLHGFEQSITITLPPMSVLYFEVPAKRTRKTAEEKAAEKAAPKKASKTAK
AEKAEEKAPAKRGRKPKAEAAPAEEKAPAKRGRKPKAEAAPAEEKAPAKRGRKPKAEKAA
EPAEKTARKPRAKKADKAEK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	184	484	1.4e-161	0.9966777408637874
CBM48	32	117	5.3e-21	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	10	632	5	626	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	32	632	27	620	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	14	631	605	1220	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	14	633	8	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	13	636	101	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA81819.1	0.0	1	682	1	682
CBK98932.1	0.0	1	682	1	682
ATL90043.1	0.0	1	643	1	643
CBL01646.1	0.0	1	646	1	646
AXB29737.1	0.0	1	646	1	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQZ_A	1.39e-227	13	649	130	791	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	1.97e-227	13	649	130	791	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	1.97e-227	13	649	130	791	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	3.95e-227	13	649	130	791	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	7.90e-227	13	649	130	791	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	2.15e-257	12	632	6	626	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q1AZ86	1.61e-247	13	630	100	716	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q5NXV7	1.22e-245	8	630	6	624	1,4-alpha-glucan branching enzyme GlgB OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=glgB PE=3 SV=1
O66936	8.53e-242	13	632	8	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q3SH78	3.33e-241	14	632	118	737	1,4-alpha-glucan branching enzyme GlgB OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002545_01169.