CAZyme Information: MGYG000002548_01568

Basic Information

• Species: Staphylococcus argenteus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus argenteus
• CAZyme ID: MGYG000002548_01568
• CAZy Family: GT2
• CAZyme Description: Teichoic acid glycerol-phosphate transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		46003.45	7.278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002548	2783391	Isolate	China	Asia

• Gene Location: Start: 19596; End: 20765 Strand: +

Full Sequence      

MIKTTIKKMIERCIHTSFKLLSKLPNKNLIYFESFHGKQYSDNPKALYEYLVEHSDAQLV
WGVKKGYESIFNQHNIPYVTKFSMKWFLTMPRAKAWMINTRTPDWLYKGSQTTYLQTWHG
TPLKKIGLDISNVKMLGTTTTAYQDGFKKESQRWDYLVSPNPYSTDIFQHAFRVNRDKIL
ETGYPRNDKLTHKQNDTEYINRIKTRLNIPLDKKIIMYAPTWRDDEAIREGSYQFNVNFD
IEALRQALDDNYVILLRMHYLVVTRIDEHDDFVKDVSDYEDITDLYLISDALITDYSSVM
FDYGVLKRPQIFYAYDLEKYGDELRGFYMDYKKELPGPIVENQAALIETLKHIDITANDY
VAERTAFYQKYCSLEDGHASQRICQTLFK

Enzyme Prediction     

No EC number prediction in MGYG000002548_01568.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	4.97e-163	26	389	3	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.88e-129	3	389	1	386	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG63304.1	1.22e-127	30	383	355	710
APR60016.1	1.22e-127	30	383	355	710
QQS82065.1	1.22e-127	30	383	355	710
AYX90860.1	4.87e-126	28	389	353	716
AVI00617.1	8.07e-126	26	387	354	716

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	7.04e-120	30	389	355	716	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	7.80e-119	30	389	355	716	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	2.19e-118	30	389	355	716	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G1C1	3.99e-264	1	389	1	389	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P13485	2.60e-127	8	389	361	744	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q5HLM5	3.13e-119	30	389	355	716	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKI5	4.74e-119	9	387	12	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q8RKJ1	1.04e-35	3	387	2	380	Teichoic acid ribitol-phosphate primase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarK PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002548_01568.