CAZyme Information: MGYG000002549_00239

Basic Information

• Species: Bacteroides caccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides caccae
• CAZyme ID: MGYG000002549_00239
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930	MGYG000002549_1|CGC5	105734.55	6.3789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002549	5479119	Isolate	United States	North America

• Gene Location: Start: 302047; End: 304839 Strand: +

Full Sequence      

MNKLITLILVCCFAFNLYAEQLPAKQFSHPERIRYDQHCFTIEGRDIFILSAAFHYFRVP
QELWRDRFRKIKEAGFNTVETYVPWNWHERTMPRNVKDYSQCDFDDLKAWLKMAHEEFGL
YTIVRPGPFICAEWAGGGYPRWVAKSCPAKYDTSFWLRSNHPEHMKWTKHWYDAVCPVFA
EEQLTRKKSGEKGIIMVQLENEYIYFGMESEKKEEVLRDMAAYCTNNGIEVPLFTCVTPE
VRGSKDAVISQLFDMDNQYVWWNIQEAKSRIEDLKRQQPNAPAFVCELQGGWFSTVGGGL
SEDSYLDGRHARGMALMAMAGGSTGLNYYMFFGGTNLAGWGARRMTTSYDYGAALKESGG
VSEKFAAVKGVGDFVNRFGTQLARSEAIEFTTSDNIKDLTVGVRRTKEGTLFIFIFNKDK
KKAFRDNVQFHIKGMPAFNVYCSVEPLDSKVLVLSQANGQCEWYPKEQTLPERPVNMPMP
IRIAQAERCDETFQGNWRPLRKGVSLPEIGVNDCRYSMYRSVVKLSKKEVEEYGTLVCEM
FTADPLYVQVNGKIAKRASTDELDNTFVIDGLLHEGNNEIVSIYENRGHAHGYRPMEELS
GMKSAGLGKKQSAILPIEKWEVKKVENNVKDIKSLLSNNEGWETIMLDQSTIANLATLQI
AGLEKPEWPAAWVLQGKEGTAIYRTEIEFTPEMIAERKTMIEFACVDDAGTLWVNGKEVA
SHDAWDKPFVVNIAPYIHNGKNDIAIIVRNQSGAGGLLKGVRLFSELRIKKLLQWEVSSD
LGGVVQKICDGITTNGNWEVVSLKTDGMLARKGNNIQPKGKRDALLTWYKVTFDLPTQSA
DCWIPWRAVINASGTGYMWLNGHNIGRHWEEGPQREFYLPECWLNMGGSNTLVLGLRQSE
NGGAVLEGIEIVPYYEDAEIRIKTNDYEKE

Enzyme Prediction     

No EC number prediction in MGYG000002549_00239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	40	371	1.6e-94	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	5.54e-76	40	372	2	315	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.34e-31	33	363	30	329	beta-galactosidase; Provisional
COG1874	GanA	1.12e-22	33	203	1	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	6.17e-09	642	752	24	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02449	Glyco_hydro_42	6.10e-05	57	203	5	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU07680.1	0.0	1	930	1	930
QRP57068.1	0.0	1	919	1	920
ASM65763.1	0.0	1	919	1	920
QQT77688.1	0.0	1	919	1	920
QCQ49125.1	0.0	2	919	7	924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	5.37e-42	20	371	11	335	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3THC_A	4.70e-37	33	371	11	330	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	5.72e-37	33	371	35	354	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
6EON_A	1.06e-36	40	412	35	380	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3WF3_A	1.35e-36	33	371	35	354	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5R7P4	2.33e-37	33	371	34	353	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q60HF6	2.42e-36	33	371	34	353	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P16278	3.11e-36	33	371	34	353	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q58D55	1.92e-35	32	378	32	356	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
O19015	3.88e-35	32	371	34	354	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999148	0.000176	0.000158	0.000146	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002549_00239.