CAZyme Information: MGYG000002549_00807

Basic Information

• Species: Bacteroides caccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides caccae
• CAZyme ID: MGYG000002549_00807
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000002549_5|CGC9	37450.07	9.302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002549	5479119	Isolate	United States	North America

• Gene Location: Start: 364274; End: 365254 Strand: -

Full Sequence      

MKKQIKINYILTLILVFCIGATIPTLIGSSQVNEQHSAKSEVPYCVTSPTVPAQVTFDGE
TIDLRRYDRRERMDREILAFTYMHSTTMLLIKRANRYFPIIEPILKANGIPDDFKYLMVI
ESNLNSIARSPAGAAGLWQFMPTTGREFGLEVNENVDERYHIEKATVAACKYFKQAYAKY
GDWIAVSAAYNAGQARISSQLEKQLASHAMDLWLVEETSRYMFRLLAAKEIFSNPQRYGF
LLKREHLYPPIPYKEVTVSTPINDLSEYAKKQGITYAQLRDANPWLRETSLKNRSGKSYV
LHIPTQEGMHYDPKKTVAYNKHWVID

Enzyme Prediction     

No EC number prediction in MGYG000002549_00807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	97	233	4.4e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	2.73e-60	105	230	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	1.12e-25	81	284	92	293	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	4.99e-23	100	197	1	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.61e-17	117	228	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.52e-13	97	233	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU08227.1	5.11e-241	1	326	1	326
QRP57342.1	1.47e-240	1	326	1	326
QQT77414.1	1.47e-240	1	326	1	326
ASM66026.1	1.47e-240	1	326	1	326
QIU94901.1	1.49e-224	1	326	1	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	9.89e-25	70	301	78	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	9.89e-25	70	301	78	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.493318	0.488047	0.014495	0.001281	0.000637	0.002205

TMHMM  Annotations     

start	end
7	29