CAZyme Information: MGYG000002549_01167

Basic Information

• Species: Bacteroides caccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides caccae
• CAZyme ID: MGYG000002549_01167
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	MGYG000002549_6|CGC3	50016.5	4.4276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002549	5479119	Isolate	United States	North America

• Gene Location: Start: 180809; End: 182134 Strand: -

Full Sequence      

MKKIYSILVTIVFLILTASCNENFEIADKADSLVSVAINTLNIQKSFNVGESYQAELWVQ
RGGLSDMSGKVKFMIDPNLLDSLNREDRTNYQMLPENCYELSNIEFLLNKNEMCGYITYH
PEKIVELSDYDQIQYVLPLRLVSNELNINPERCVSLLAFQVSEPIVQITNSGIFNIDPLQ
TSQMDVHISVPFTNKWDIECDLTHDQSLIEQYNSNNKVNFTLLPSESYTAPDKISLPEGV
NETTASYQLKDNLLPGNYILPITIGSIEATQNGTPNNSLVIDKESSTLFRIVKEGKKIDK
SKWEIIACNSEAAANPVKNLIDDDETTFWHCKTKSEANWCEPPYEITIDMKDPVTIAQID
LVNRGEASRANNIKWVEFYASNNNSNWEKIGASDFNDEFIRETFRYYVKSTTARYLKLVI
PEGHGNACPPAAIRELTVFGY

Enzyme Prediction     

No EC number prediction in MGYG000002549_01167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	309	437	3.6e-19	0.9112903225806451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	6.65e-17	304	436	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam08522	DUF1735	3.56e-11	165	268	7	117	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam08522	DUF1735	5.25e-11	44	148	18	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU08575.1	0.0	1	441	1	441
ASM66238.1	0.0	1	441	1	441
QQT77186.1	0.0	1	441	1	441
QRP57568.1	0.0	1	441	1	441
QMW86943.1	1.18e-217	1	440	1	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GGL_A	1.04e-29	284	440	1	157	X-RayStructure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. [Bacteroides thetaiotaomicron],6OE2_A X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. Re-refinement of 3GGL with correct metal Mn replacing Zn. New metal confirmed with PIXE analysis of original sample. [Bacteroides thetaiotaomicron]
3F2Z_A	7.65e-28	295	440	2	147	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]
2KD7_A	1.43e-26	295	440	2	147	ChainA, Putative chitobiase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000074	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002549_01167.