CAZyme Information: MGYG000002549_01676

Basic Information

• Species: Bacteroides caccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides caccae
• CAZyme ID: MGYG000002549_01676
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	MGYG000002549_6|CGC10	75959.45	5.5755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002549	5479119	Isolate	United States	North America

• Gene Location: Start: 758119; End: 760128 Strand: +

Full Sequence      

MKVKHLVVAFLCMLGCCACSSPKTEVKSPDGHIKMTLTVDENGTPFYNVSVNDSLLIENS
KMGFVEGNGVILGGGFRIEKTTFDSKDETWTQPWGENKTNRNHYNEMAVNLINEDQVQLT
LRFRVFNDGVGFRYEYNVPNVDSLMITDELTTFHFRQDGTSWSIPASAETYELLYKQQPI
SEVETANTPFTFKTADGVYGSIHEAALYDFSEMTLKQIGDYTLKAELTPWPDGIKVRKSN
HFTTSWRTIQIAPEAVGLINSSLILNLNDPCVLETTDWIRPLKYIGVWWGMHLGVETWKM
DERHGATTVNAKKYIDFAAANNIEAVLFEGWNEGWESWGGMQNFDFTKPYADFDIDEIVR
YAKEKGIEIIGHHETGGNIPNYERQMDHAMQWYTDHSIHILKTGYAGAFPNGLSHHGQYG
VNHYQKVVETAAEHRMTLDAHEPIKDTGIRRTWPNMMTREGARGMEWNAWSEGNPPSHHV
MLPFTRLLSGPMDYTPGTFDILFQQTKDSPRRRKWNDQDKGNSRVNTTLAKQIANWVILY
SPLQMASDMIEHYEGHPAFRFFRDFDPDCDESKALAGEPGEFVAVVRKAKNNYFFGAATN
EAPRTLEIKLDFLKPGKQYKAVIYADGEKADWKTNPADYQITEQTVTAENTLTVRMAAGG
GQAISFIQL

Enzyme Prediction     

No EC number prediction in MGYG000002549_01676.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	12	666	1.1e-232	0.993660855784469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	5.85e-144	276	565	2	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	7.79e-88	28	270	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	6.03e-43	569	667	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
cd06563	GH20_chitobiase-like	0.008	288	372	3	111	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU09059.1	0.0	1	669	1	669
QQT76721.1	0.0	1	669	1	669
QRP58029.1	0.0	1	669	1	669
ASM66687.1	0.0	1	669	1	669
QIU96187.1	0.0	1	669	1	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	1.76e-196	26	666	3	658	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	1.76e-196	26	666	3	658	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	4.99e-196	26	666	3	658	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	1.31e-162	25	665	4	702	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2D73_A	1.33e-162	20	665	19	722	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	6.53e-163	7	665	9	722	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	9.74e-56	3	664	1	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	4.85e-29	49	610	63	574	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000036	1.000008	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002549_01676.