CAZyme Information: MGYG000002549_03250

Basic Information

• Species: Bacteroides caccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides caccae
• CAZyme ID: MGYG000002549_03250
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
937	MGYG000002549_16|CGC2	106069.35	4.792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002549	5479119	Isolate	United States	North America

• Gene Location: Start: 38723; End: 41536 Strand: -

Full Sequence      

MKNIFAILLLCSTIVCCACGSEDEKEMITPVLEVGSKNVYVGESAVTREISITSNVEWSA
SVASEGQAWCHVDLQSDRLLIHIDENTEKDVRKTSIQIAASQLKETIQVAQLGWGKAILV
SPKSIKVLPIGEEFSFEVTANIEYNVEIEEGCNWIHVVPKTRSTHEMVTNTFVYKADLNA
TEYRETTIWVKDKDENSEIESGSLTVTQEKMKDNYESTGIEGIKEDIKVQVIRGEANKAQ
SISEGIEKTFDGDMNTIYHSPYNDNKVTEESPAILTYYFDEGADMDYLVYYPRTDGGANG
RFKEVEIRVRSNANTYGTDEWTTVIKKNLGGSSSAARIDFPVSQIGVSAVQIVVNSGIGD
FASCAEMEFYKKNPDPFDYSVLFTDASCSELKPGVTEEDIQNCNYSFFKNIAYYMYRQKY
PREFRIAEFKAYPHPDIQKAINKTSAYSLLDNPTGIYVAQGQELVVLVADAHNEDMGICI
QNLDKPGGDGFGGDTYPLTTGVNKIKVKNKGLVYVIYHTTSLEELTGKQPVKIHFASGKV
NGYFDSNKHEASRWSELLNNTVCGYFDVLGTYAHLTFPVNRLRNSTGNRGKELIDLYDEI
VEKEQIFMGLKKYGGMFMNRMYLNVMYHNFMYASDYHTAYHDDTMDELCNPDRLKTTGCW
GPAHEIGHCNQTRPGLKWHGLTEVTNNIMSQYIQTTVWGNTSRLQSEGWYTKAWDEIIAK
RRAHAQETDFFMKLVPFWQLELYWGKVKGFTPKESNGWDGFYLQIYEHIRKNPDLPTAGE
QQLEFVYICCLKAEKDLTGFFRKWGFLTPVDVTVDDYGDGKIIVTQKQIDEILAKIDLLG
FEKETAAFEYITDDNLNYFIENKPVQAGTSSKEGGAITLNNWKNVVAYEVENENGELVYV
VNALERPYGFTVPSWKDSYKVYAVSAAQGRIEVTFNK

Enzyme Prediction     

No EC number prediction in MGYG000002549_03250.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	7.27e-56	538	805	1	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
cd14948	BACON	3.08e-11	32	111	2	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
cd14948	BACON	8.90e-08	117	209	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam17291	M60-like_N	1.73e-07	453	534	22	107	N-terminal domain of M60-like peptidases. This accessory domain has a jelly roll topology.
NF037974	SslE_AcfD_Zn_LP	0.002	664	804	1183	1344	SslE/AcfD family lipoprotein zinc metalloprotease. Members of this family are surface lipoprotein zinc metalloproteases, from the family that includes accessory colonization factor AcfD from Vibrio cholerae, SslE (YghJ ) from E. coli (Secreted and Surface-associated Lipoprotein from E. coli), and VPA1376 from Vibrio parahaemolyticus. Each is about 1500 amino acids long, and SslE is a known substrate of a type II secretion system (T2SS). SslE is known to have mucinase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU06907.1	0.0	1	937	1	937
QRP56391.1	0.0	1	937	1	937
QQT78364.1	0.0	1	937	1	937
QCT79445.1	0.0	18	935	20	939
QRP89238.1	0.0	18	935	20	939

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SCI_A	4.95e-73	382	843	14	477	ChainA, Peptidase M60 domain-containing protein [Akkermansia muciniphila ATCC BAA-835]
5KD2_A	4.45e-56	382	931	34	605	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5KD5_A	6.38e-52	414	931	20	557	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]
4FCA_A	6.69e-29	453	813	45	386	Thecrystal structure of a functionally unknown conserved protein from Bacillus anthracis str. Ames. [Bacillus anthracis str. Ames]
7BLG_A	2.96e-28	224	372	20	162	ChainA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLH_AAAA Chain AAAA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLJ_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLK_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5R8R3	3.69e-10	511	813	612	897	TRPM8 channel-associated factor 1 OS=Pongo abelii OX=9601 GN=TCAF1 PE=2 SV=2
Q9Y4C2	8.37e-10	511	806	612	890	TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 PE=1 SV=3
A5PJN5	2.49e-09	511	806	612	890	TRPM8 channel-associated factor 1 OS=Bos taurus OX=9913 GN=TCAF1 PE=2 SV=1
Q921K8	2.49e-09	454	815	548	900	TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1
A6NFQ2	3.80e-08	511	816	612	898	TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000006	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002549_03250.