CAZyme Information: MGYG000002552_01666

Basic Information

• Species: Lachnospira sp000436535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp000436535
• CAZyme ID: MGYG000002552_01666
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	MGYG000002552_9|CGC1	59657.13	4.3152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002552	3071336	MAG	China	Asia

• Gene Location: Start: 76720; End: 78381 Strand: +

Full Sequence      

MKKKSIVAAISALSLIVSMNTGIGSVFAGEQSTVPGTAKQPFVVTDGLFDQTKTESDLGL
PKIEGAETVTVFTATDDTDHYCNGVVMTEFKGKLYTQWQSSAKDEDAEDTWVAYSVSDDN
GATWSEPKVLVPTIDNGYCSSGGWFVSGDTLVSYINVWYSDTTPRGGFAYYVESTDGEHW
SEMKPVLMKDGTPMEGIIEQDPHVLASGRIVNAAHFQPGLFAYPIYTDDPSGTKGWVKAQ
YTCMEQGEGATTSREMEPSLFVNEDGTIVMTFRDQNSSFVRLAAISTDQGETWSETVSTN
MPDCRAKQSAGNLPDGTAYLVGCSVNNKGRWPLTITLSSDGKTFDTAYVLRTHDEFPELK
YTGKAKRLGFHYPKSVVIGDYLYISYATSKEYVEYTRIPLDAISLNADKEAPVISGIEDG
AEYTDSVTFTVEDANLKSVTVNGEALTAEDGKYTLTVSDGQQVVVAEDEAGNKTVVKVMV
KASANNSTDDTTKATDASENTNTNSDSNSNSNSNSNVSTPQTGDTMMRVAAIMAGLLLAS
GLVIFAAGKKRRA

Enzyme Prediction     

No EC number prediction in MGYG000002552_01666.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	91	350	3.7e-19	0.6198830409356725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	1.09e-50	92	384	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	8.80e-29	69	372	1	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	0.002	245	399	230	372	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
TIGR01167	LPXTG_anchor	0.004	520	552	3	34	LPXTG-motif cell wall anchor domain. This model describes the LPXTG motif-containing region found at the C-terminus of many surface proteins of Streptococcus and Streptomyces species. Cleavage between the Thr and Gly by sortase or a related enzyme leads to covalent anchoring at the new C-terminal Thr to the cell wall. Hits that do not lie at the C-terminus or are not found in Gram-positive bacteria are probably false-positive. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region. [Cell envelope, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79596.1	5.65e-121	39	400	342	701
QDT98687.1	8.79e-17	60	345	27	319
ADY61523.1	2.85e-16	81	389	277	580
QDV41049.1	8.66e-16	35	403	217	592
QDU09961.1	9.20e-16	61	345	28	319

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000279	0.998950	0.000246	0.000182	0.000179	0.000150

TMHMM  Annotations     

start	end
7	29
529	548