CAZyme Information: MGYG000002554_00228

Basic Information

• Species: Streptococcus oralis_W
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis_W
• CAZyme ID: MGYG000002554_00228
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002554_15|CGC1	42616.97	4.8869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002554	1500206	MAG	China	Asia

• Gene Location: Start: 6117; End: 7220 Strand: -

Full Sequence      

MKTNKLKYVWFVLILSIFCLALFLARGRTKIEMRNRIYSQWSQQFLVTKGDQSYVRTTSD
SEGTTVLSEAQSYGMLITVLAAQKGQASQADFDNLYRYYQNHRIEDTQLMSWKQVIKNDS
ETVEKQNATDGDLYIAYSLIEAAKQWPDKAQEYQAQAKKILEDILRYNYNEETGVLTVGN
WANKDSDYYYLMRTSDTLPHYFQSFYDLTGNQQWLDIKDKMLGQLEQISSHSDTGLLPDF
IWAEKSGARLVDANTIESQYDGAYSYNACRLPYHLSQSQDERSQKLVQKMMDFFMKEQRI
YAGYDLNGTALNQYQAGSFLAPITYASDKGEGYLKLLQQNKYIFTQDLPLDNYYDATMIT
MIALEMF

Enzyme Prediction     

No EC number prediction in MGYG000002554_00228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	363	3.5e-71	0.978125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	4.31e-25	38	364	8	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	2.78e-22	37	296	25	277	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	2.67e-09	64	173	52	153	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLL97167.1	1.03e-263	1	367	1	367
AQA08566.1	8.46e-263	1	367	1	367
AHZ47396.1	4.89e-262	1	367	1	367
CBZ00311.1	4.89e-262	1	367	1	367
QQL00752.1	2.83e-261	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	1.68e-39	29	322	54	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.19e-27	38	327	35	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.36e-27	38	327	41	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	1.65e-11	68	276	33	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
3QXQ_A	2.81e-07	38	266	7	227	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.28e-38	38	322	66	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	4.22e-24	38	326	91	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P27032	7.93e-08	69	275	53	248	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P37696	1.10e-07	56	274	44	252	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8X5L9	3.81e-07	38	266	28	248	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.861681	0.087657	0.046789	0.000413	0.000267	0.003204

TMHMM  Annotations     

start	end
7	25