CAZyme Information: MGYG000002554_00264

Basic Information

• Species: Streptococcus oralis_W
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis_W
• CAZyme ID: MGYG000002554_00264
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	MGYG000002554_19|CGC1	63410.45	4.6557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002554	1500206	MAG	China	Asia

• Gene Location: Start: 2260; End: 3942 Strand: -

Full Sequence      

MMTKIKPHGPLPSQAQLDYLEDELAAFIHFGPNTFYDQEWGSGQEDPKRFNPTKLDAREW
VRVLKETGFKKLILVVKHHDGFMLYPTAHTDYSIKASPWRDGKGDLLLEVSKAVTEFDMD
MGVYLSPWDAHSPLYHVDREADYNAYYLAQLKEILSNPAYGNVGKFTEVWMDGARGEGAQ
KVNYEFETWFETIRDLQGDCLIFSTEGTSIRWIGNERGYAGDPLWQKVKSDQLGTEAELD
YLQHGDPSGTLFSIGEADVSLRPSWFYHEDQDPKSLEELVEIYFHSVGRGTPLLLNIPPN
QDGLFDEKDIQRLYEFAAYRDELYKEDLALGTKVYGPALSPDFACHHLTDGLETSSWASD
AELPVQLELDLGSPKTFDVIELREDLKLGQRIAAFHVQVELDGVWQEFGSGYTVGYKRLL
RGSVVEAQKIRVTITEAQALPLLTKISLYKTPTLSRKEVVQQLEFSEKSLAVTKGENVHF
TVKRIESSRPLEAKISIQPGTGVHGVAYRDEIQVLAFQVGETEKKLTLPTLYFAGDKNLD
FYLNLTVDGQLVDQLQVQVS

Enzyme Prediction     

No EC number prediction in MGYG000002554_00264.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	15	320	4.6e-72	0.8554913294797688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	2.65e-178	2	449	1	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	4.51e-33	27	316	31	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	1.00e-29	50	319	79	327	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEF79836.1	0.0	2	560	1	559
QQL01374.1	0.0	2	560	1	559
QRO08002.1	0.0	2	560	1	559
AHZ48635.1	0.0	2	560	1	559
ATF57525.1	0.0	1	560	20	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ORG_A	3.42e-316	2	452	1	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	5.45e-315	2	452	1	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	5.66e-315	2	452	1	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6TR3_A	6.04e-106	11	451	27	505	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]
6TR4_A	9.37e-105	11	451	27	505	Ruminococcusgnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1],6TR4_B Ruminococcus gnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	4.30e-119	5	449	27	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	2.31e-112	7	476	35	499	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	1.84e-12	35	315	82	348	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
P17164	2.49e-07	49	304	105	342	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q6AYS4	3.27e-07	50	319	99	351	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002554_00264.