CAZyme Information: MGYG000002554_00399

Basic Information

• Species: Streptococcus oralis_W
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis_W
• CAZyme ID: MGYG000002554_00399
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		22052.31	4.3654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002554	1500206	MAG	China	Asia

• Gene Location: Start: 18; End: 647 Strand: -

Full Sequence      

MSLTTKKIKTTIAGVAALLAFFAPALASAQETVTYTVKSGDTLSEIAEKYNTTAEKLAAK
NNIKDIHLIYVDQVLVIEGTASTAAPAATTEETAPVATETVEEAPAATTTYEAPAAPAPA
VPAAENNTASASTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYSAEN
QERVADAYVAGRYGSWTAAKNFWLNNGWY

Enzyme Prediction     

No EC number prediction in MGYG000002554_00399.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.83e-13	33	77	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.45e-13	34	77	1	44	Lysin motif.
pfam01476	LysM	5.81e-13	35	77	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK11198	PRK11198	9.12e-06	29	77	92	145	LysM domain/BON superfamily protein; Provisional
COG1388	LysM	1.37e-05	28	77	62	110	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA07376.1	1.61e-112	1	209	1	206
BAV80643.1	2.15e-111	1	209	1	210
CBZ01503.1	3.86e-109	1	209	1	208
VEF79810.1	3.35e-106	1	209	1	211
QQL00262.1	1.93e-105	1	209	1	211

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54421	1.73e-07	34	85	150	200	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O07532	2.29e-06	34	84	308	357	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O34669	7.69e-06	28	89	70	132	Cell wall-binding protein YocH OS=Bacillus subtilis (strain 168) OX=224308 GN=yocH PE=1 SV=1
Q49UX4	8.48e-06	34	85	87	137	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000405	0.998755	0.000207	0.000222	0.000203	0.000178

TMHMM  Annotations     

start	end
12	34