CAZyme Information: MGYG000002555_00824

Basic Information

• Species: Megasphaera sp902388315
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp902388315
• CAZyme ID: MGYG000002555_00824
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000002555_48|CGC1	42595.87	7.2084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002555	2144821	MAG	China	Asia

• Gene Location: Start: 3396; End: 4550 Strand: -

Full Sequence      

MKIMFSAGEASGDLHGANLARSLRELDPQIELLGMGGREMAAAGVDIIYDIKNLGVIGVG
EIIRKIPFFFRLRDFLVDTMRREKPDVLVCIDYPGFNMRLIKAAKAAGIPVIYYILPTIW
AWHKSRGKTIAKYTDLAISLFPFEARMYADMGTNVIYAGHPLVDTVHATMSRREACAYFG
LDERKPAVLLMPGSRVQEVRGLLPCMLEAAKLIRKEAGDVQFILPRASTIDETLLDELIR
PSGIDVTIGEDRVYDMMNLSTAAIAASGTATLETALMGLPTLLIYRVNRLTYWLSKVLVH
IDSIGLPNIIMGHRVIPELWQDEVTPAHIAAAMVPMITDKVRREALHESLTAVRRTMGEP
GAVQRTTQAILDFARERGAHEAIQ

Enzyme Prediction     

No EC number prediction in MGYG000002555_00824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	357	2e-121	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	7.22e-142	1	378	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.35e-127	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.12e-103	3	373	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.71e-95	3	373	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.36e-57	1	326	2	306	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCC72315.1	5.74e-265	1	384	1	384
AVO73783.1	5.74e-265	1	384	1	384
ALG41186.1	1.65e-264	1	384	1	384
AVO26605.1	1.11e-262	1	384	1	384
AXB81636.1	5.06e-198	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.63e-61	1	375	7	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.84e-60	1	375	7	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	3.77e-101	2	373	8	379	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	2.14e-100	2	373	8	379	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	1.71e-96	3	376	6	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	7.91e-92	2	376	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	5.04e-90	2	373	6	377	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000030	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002555_00824.