CAZyme Information: MGYG000002555_01276

Basic Information

• Species: Megasphaera sp902388315
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp902388315
• CAZyme ID: MGYG000002555_01276
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		47369.14	9.8834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002555	2144821	MAG	China	Asia

• Gene Location: Start: 2939; End: 4180 Strand: +

Full Sequence      

MYEFHAKQEDVALSVWQRLWQKIMASPAVILLVLAAILCFVANHLLVVTDPVESNYVLTA
KEMLASGDYFSPRIFGNYWYDKPIFFYWELIAAFKLFGISDFSARFFPALFGVAGILLAY
GFTARLYDKKTGFLTGLILLTTVEYFYLSKAIITDMTLFVFYSACLMAFYIAYSEEKPRW
YYLAYAFAGLAVLTKGPIGFFQPGLIILIFLLWRRDLKALLHIKLFSGLALFLAITLIWY
GPMYAMHGSDFVSQFIGVHNVLRATVSEHPQYNVWYYYSAIFLAGFVPWVFTLPLAWRDY
GLTRKIAAAWREKRLRLPALSMKTQFLIVWAAVIFVTYQLMATKYMTYTFPYMIPLAIGF
ASYLKKYDRLVLNMAGIVLAIYVAVSRYLYGRRPPVPAGFGVSGRSGRQQSGR

Enzyme Prediction     

No EC number prediction in MGYG000002555_01276.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	28	386	2.6e-88	0.6407407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.16e-42	20	361	2	333	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.59e-25	24	366	2	335	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.03e-19	81	239	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.18e-11	53	247	32	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	6.81e-09	76	195	56	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO27725.1	4.30e-262	1	386	1	386
AVO74995.1	6.43e-257	1	386	1	386
CCC74317.1	6.43e-257	1	386	1	386
ALG42265.1	9.01e-250	11	386	1	376
AXL22207.1	4.94e-160	11	389	18	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.66e-25	29	351	35	351	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.80e-25	51	390	28	359	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q4K884	5.09e-23	51	391	63	405	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
A4SQX1	1.70e-20	50	362	27	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
O67601	2.84e-20	43	397	20	340	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A0KGY4	4.10e-20	50	362	27	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48
102	124
151	173
183	212
219	241
275	297
318	340
345	364
369	391