CAZyme Information: MGYG000002556_00044

Basic Information

• Species: CAG-279 sp000437795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp000437795
• CAZyme ID: MGYG000002556_00044
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		35593.13	9.1659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002556	2634532	MAG	China	Asia

• Gene Location: Start: 53286; End: 54212 Strand: -

Full Sequence      

MKLQNKIAIVVFAVTMPFMPMLAQGNAVAYAPVIPEKVHFADRVVDLDRIDFYERMDREM
ISFAFGHTNTLLTIKRANRYVPGIVKILKEQGVPEDLVYLAAIESHYDNAAVSSAKAVGM
WQFMPSTAKEYGLEVNEYVDERLDCDKSTVAACKYFKRAYAKYKCWLTVAAAYNAGMGRI
SKSLETQDVEHALDLYLNKETSRYIFRLLAMKLIIENPARYGYAIKANQLYQPLDCDTFV
VAEPVKDWVQWSKEHNITYSLLREYNPWIRSVSLPNPNNKTYVVKIPKETSLYRSKQTLK
TYRENWTR

Enzyme Prediction     

No EC number prediction in MGYG000002556_00044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	88	212	5.3e-21	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	2.73e-60	88	212	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	1.17e-27	67	222	95	251	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	7.80e-25	92	182	9	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.24e-15	95	210	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	3.57e-14	100	180	15	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35372.1	5.40e-114	31	306	55	330
ASB38769.1	3.17e-110	32	306	44	318
QQR09511.1	3.17e-110	32	306	44	318
ANU63153.1	3.17e-110	32	306	44	318
QCD43280.1	1.73e-106	23	306	42	325

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.08e-20	54	222	79	248	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.08e-20	54	222	79	248	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	6.95e-10	70	250	15	199	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31608	4.75e-06	84	182	64	158	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000371	0.998893	0.000228	0.000184	0.000161	0.000146

TMHMM  Annotations     

start	end
7	29