CAZyme Information: MGYG000002558_01235

Basic Information

• Species: Prevotella sp900540415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540415
• CAZyme ID: MGYG000002558_01235
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000002558_20|CGC1	40463.27	6.2458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002558	3471678	MAG	China	Asia

• Gene Location: Start: 9311; End: 10402 Strand: -

Full Sequence      

MRKPLLLLALAASVCAVAQQRLLGGDISMLPSYEESKAVYRDSEGKAVKPLEMFSQLGWN
AMRVRLFVDPGLAPADHKDEGVCQDIGYVKRLGAKIKRAGFRFMLDFHYSDTWADPGKQF
MPARWSGVPRTALPDSVYAYTRASLEALVGAGAAPDLIQVGNEISNGMMWPEAKTSPFDD
ANQQLFGSLLAAGCRACRDVCPEAKVIIHTEKAGDWAFTKAFYDRLATLDYDVIGLSYYP
MWHKAVGVLSATLDSLAVRYPDKPVMIVETAAYYSHANDRWATSPDQYAEFYPISIDGQR
MFTRELVAELRRHANVTGLFWWFPEENGSCGSMMGNWINRGLFDNRTGRLLPAAYDFMGF
IGE

Enzyme Prediction     

No EC number prediction in MGYG000002558_01235.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	24	352	3.4e-87	0.9766081871345029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	2.00e-85	24	353	3	329	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	4.18e-66	24	325	42	343	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT66820.1	2.44e-176	18	361	21	364
QVJ80245.1	1.54e-103	20	360	23	375
AGB28452.1	1.91e-98	20	362	21	369
ADE83762.1	8.41e-96	20	360	23	368
VEH14955.1	2.54e-90	21	360	47	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	4.60e-46	24	357	53	391	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1FHL_A	1.91e-36	24	331	6	306	CrystalStructure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
4BF7_A	2.81e-34	24	340	23	338	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJS_A	1.37e-33	24	332	6	308	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1R8L_A	3.23e-32	14	324	17	322	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	2.70e-51	22	350	7	340	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
A1D3T4	2.91e-39	5	332	5	331	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
Q0CTQ7	3.49e-39	16	332	12	324	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1
Q4WJ80	8.31e-37	7	340	10	344	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
P48841	8.88e-37	5	357	11	365	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006582	0.648850	0.343574	0.000372	0.000291	0.000308

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002558_01235.