CAZyme Information: MGYG000002558_01291

Basic Information

• Species: Prevotella sp900540415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540415
• CAZyme ID: MGYG000002558_01291
• CAZy Family: PL4
• CAZyme Description: Rhamnogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631	MGYG000002558_22|CGC1	68739.99	4.9335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002558	3471678	MAG	China	Asia

• Gene Location: Start: 266; End: 2161 Strand: +

Full Sequence      

MRQRLLSAIGMAAMVCIGASAQSDVTLTRNGDSYKMSNGTVSVSIGSNGRISEMTFRGGP
NVLASNGVYFDYTADKNDNLNPTTSKIVRQTADYAEVVFSNTTADLRFEQGFIMRKGVNG
VYVYVVANGTPTSSGVNLREARVCTRLNSSFVNGYVDEVMNGKIPTNAEMAVAEREENVV
QDATYRMADGSIYTKYDWAQYVVRDSLHGLMNVNSGVWNIPCSHEWLNGGPMRQELTVHA
TSKSPITIQMLQGEHFGASSQRYEDGERKIYGPFLIYLNRGSQQQMIADAKRQASQQQAE
WPFAWFEHELYPLDRSTVRGRLSVTTGQPCDSVQLVLAEAGTSPYAQGKGYMFWAMTGAD
GSFAIPNVRKGTYTLYGYATKGGVTDELQRADIEVGGSDVDLGVVEWTPECRERLLWQIG
ENNRLADGFMYSDTCRAYGLWELPPADLNYIIGESDPATDWYFAQTKNGTWTVSFNLDDN
LSGTALLTASMAGVTNNPKVEVAVNGTVQANWNLAQNDAAIYRSAVLGGNHRVETCEFPA
SVLHKGTNTVAFTMSGIRSNGGVMYDCIKLEAGAKVVSGISEADVEVADGPVELFTVGGQ
KIGVFNSIGEAGLDGGIYIYRRGARSGKIVL

Enzyme Prediction     

No EC number prediction in MGYG000002558_01291.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	25	568	2.2e-130	0.9963702359346642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10317	RGL4_C	9.76e-39	417	571	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam14683	CBM-like	3.06e-37	416	570	2	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
cd10320	RGL4_N	8.32e-34	27	287	3	265	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
cd10316	RGL4_M	4.92e-16	314	403	1	90	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam14686	fn3_3	2.72e-09	336	395	10	67	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH93641.1	6.08e-123	9	579	32	588
BAV08848.1	3.14e-103	20	572	45	595
APC39134.1	9.16e-100	69	572	59	563
QOL14617.1	4.44e-89	3	570	4	568
AUH06334.1	2.40e-88	25	570	32	576

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RJP2	3.20e-82	2	570	11	573	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1
Q2U5P7	1.98e-19	11	554	9	635	Probable rhamnogalacturonate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rglC PE=3 SV=1
Q0C7K7	1.64e-17	4	571	2	658	Probable rhamnogalacturonate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rglB PE=3 SV=1
Q5AZ85	2.87e-17	94	571	103	658	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2
A5ABH4	3.09e-17	94	550	104	631	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000792	0.923937	0.074441	0.000300	0.000259	0.000243

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002558_01291.