CAZyme Information: MGYG000002558_01726

Basic Information

• Species: Prevotella sp900540415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540415
• CAZyme ID: MGYG000002558_01726
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000002558_39|CGC1	60430.8	5.0031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002558	3471678	MAG	China	Asia

• Gene Location: Start: 5284; End: 6930 Strand: -

Full Sequence      

MEGMAVLAVSIVTAFGMWSCSDDDTISAALTVPLSFVSDSIAVDYTAGSATAVVESDGSH
YRIEHSDNGVITAVRAVSGGSREGGRRFDKVRIEYAENASDEARQATLALIGADGKAKSS
LTLTQKPKYETVDVTTDISITHQHVTGFGGMYNPSIWVAPADRISAGELERMYSPSGLGY
NILRLMIYPDENRWADDVDGARRAQALGAIIFACQWDCGDERADKVIVNGKSLKHLRADK
YADYADHLVRYVDFMRQNGVGIYAISVQNEPDMDFTYWSPAEIVDFTKRFGQKIRATGTR
LMGPESCGYNPDYTDAVLTDAEAMAQTDILAGHLYQGFLDTTQPYTAQRRKYVCGLYDNH
LKAAGKTWWMTEHLFNDGQDKDNADNYLEFQKWTYSLNHLALEMHHCMEGNCSAYVYWYL
KRFYGMIGDNDPERNTTPEGEPTKNGYIMAHYAKYAKGMDRVEASAAAPDLLVTAYANAS
RTEMTLVAINMGDGFRCLSIQLPSAEATAEAVETNDTVDMADAHAQVKGGKALVRMSGKG
IVSVRIKM

Enzyme Prediction     

No EC number prediction in MGYG000002558_01726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	134	504	5.5e-104	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	1.07e-58	133	531	35	412	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
cd14948	BACON	2.08e-05	34	126	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam02055	Glyco_hydro_30	1.58e-04	145	336	1	237	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58222.1	5.29e-176	18	548	18	546
QUT90760.1	1.21e-174	18	548	18	546
SCV07741.1	3.08e-173	36	546	11	516
QUT26886.1	5.78e-173	36	546	40	545
EDO10799.1	8.19e-173	36	546	40	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QAW_A	4.47e-57	133	517	3	357	Structureof modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_B Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_C Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_D Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_E Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_F Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_G Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_H Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis]
4UQA_A	8.38e-57	135	503	25	365	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4CKQ_A	4.42e-56	135	503	25	365	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQ9_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQB_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQC_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQD_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQE_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
5A6L_A	3.25e-55	135	503	25	365	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5A6M_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus ATCC 27405]
3GTN_A	1.41e-54	133	490	4	331	CrystalStructure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3GTN_B Crystal Structure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3KL0_A Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_B Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_C Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_D Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL3_A Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_B Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_C Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_D Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL5_A Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_B Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_C Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_D Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45070	1.27e-53	133	490	35	362	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
Q6YK37	1.30e-53	133	490	36	363	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
G2Q1N4	3.04e-06	108	544	6	469	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001829	0.106633	0.891277	0.000082	0.000079	0.000082

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002558_01726.