CAZyme Information: MGYG000002559_00573

Basic Information

• Species: Lachnospira sp900551945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp900551945
• CAZyme ID: MGYG000002559_00573
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798	MGYG000002559_11|CGC1	91380.93	4.8614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002559	2652289	MAG	China	Asia

• Gene Location: Start: 21288; End: 23684 Strand: +

Full Sequence      

MDKKIYNLMNWPDIEGIVYSESNNPKQLLGAHICRQGILIQVFRPDAVEINVIVTGKNTK
YPMEKVDEAGYFAVCIPGKRMISYKLELEDIKGHKYEYVDPYQYPSQLTKTFARKFNEGG
CYDVYKHLGAHKKSINGVEGINFSVYAPNAMRVSVVGDFNSWDGRIYQMTKDDETGIFEI
FIPELNTDIEYKYEIKTKYGNLLIKSDPYSLHYNMDNDFTSTICDEPAFEWQDVEWINNK
SQVCKRENKTLSICELSIDDYKDVKSAKDNAKKIKELGFDFVELMPPCEYVNNNTSGYET
IGYFAPSSRIGQPVDFMNIVNEFHKNGIGVLMDINLAFMGKDKTGLSEFDGAYVYEIADA
RLDKHPELNTAEFDYASPQVRQFLISSVLMWVEKYHIDGFRIDEVASMLYLDYGRQPGEW
IPNIYGENINLAAIDFLHTLRAVLDKKCVGTILVAEESSAWPKVTGSVKNGCLGFDYKWN
YGWKNNFISFMEKDPLFRKGEYGKLTYSMLYNYSENYMLMLSHEEFNSIKGNIIDKMPSA
KKEDKLANVRLAYAFMYMHPGKKLLNMSQLSEVEAFVKGLNEFYKNNDALFELDYEPDGF
EWVDTSLAEETVMTFIRRDSAGKELFVVANFTPVVREEYRLGVSKAGKYTEVFNSDSISF
GGQGNINEGVVKSERVEFNGKDESIVITLPPLAITVFEYEPYTLIELEEIQIRHEATMAK
RKAEEESHIAQELKLKAEEEARQAQEAAKLAQEAALAAVKAKESAEKKALLAQKASIKIE
QEMQKKLEELAKLKQKEE

Enzyme Prediction     

No EC number prediction in MGYG000002559_00573.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	274	569	9.2e-112	0.9767441860465116
CBM48	127	212	8.1e-16	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0296	GlgB	0.0	109	699	11	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK12313	PRK12313	0.0	106	701	5	629	1,4-alpha-glucan branching protein GlgB.
PRK05402	PRK05402	0.0	13	701	5	725	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	2.10e-163	14	697	508	1220	glycogen branching enzyme; Provisional
PRK12568	PRK12568	1.04e-150	12	700	13	729	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ92601.1	3.04e-224	1	699	1	732
ASU27851.1	3.04e-224	1	699	1	732
ANU75041.1	3.04e-224	1	699	1	732
QJU14853.1	3.83e-223	1	699	1	732
QBE99030.1	2.60e-222	1	699	1	732

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQZ_A	3.92e-160	14	701	30	775	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	5.53e-160	14	701	30	775	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	5.53e-160	14	701	30	775	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	5.53e-160	14	701	30	775	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	1.10e-159	14	701	30	775	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q608L5	1.77e-172	12	693	12	719	1,4-alpha-glucan branching enzyme GlgB OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=glgB PE=3 SV=1
Q1AZ86	2.17e-165	14	697	7	716	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q8DLB8	1.82e-163	14	700	8	751	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q3J3M6	3.23e-163	13	697	15	724	1,4-alpha-glucan branching enzyme GlgB OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=glgB PE=3 SV=1
A3PIQ5	4.55e-163	13	697	15	724	1,4-alpha-glucan branching enzyme GlgB OS=Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) OX=349101 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002559_00573.