CAZyme Information: MGYG000002560_00909

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_00909
• CAZy Family: GH99
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		41191.38	9.3295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 85724; End: 86773 Strand: -

Full Sequence      

MKAKIFCLFFLIVLEFIVCPQNGWAQDNTIPMIGAYYFDGWSGKNNSQELWAQEAPTHLT
EKLYNDYNERQPIWGWRNDDLAIMERQIDIASQNGITFFLFCWYWKKDKGEMDIKTIENH
ASHTSLKLFMKARNKHKMKFALLIANHQGARIEGEDNWLKAMDYMADTYFQDSQYLKIEN
KPVVALFNAKAAAPSLTKMNDYLKAKNYAGLFSISCNDKSKKYSANSWYNIREREPGYAY
RKEYEILVKNTEVTWYTYPKEYNIIPLVMAGWDQRPWEKQEKSLYYVNRTPKLFKQHLKN
AVRFVNERGCKPKMILVYAWNEYGEGGYIVPTVGDPKGQYLKMIKEVIR

Enzyme Prediction     

No EC number prediction in MGYG000002560_00909.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH99	77	341	4.7e-18	0.7634730538922155

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11579	Glyco_tran_WbsX	4.90e-30	67	349	53	347	Glycosyl hydrolase family 99-like domain of WbsX-like glycosyltransferases. Members of this domain family are found in proteins within O-antigen biosynthesis clusters in Gram negative bacteria, where they may function as glycosyl hydrolases and typically co-occur with glycosyltransferase domains. They bear resemblance to GH71 and the GH99 family of alpha-1,2-mannosidases and may share a similar cataltyic site and mechanism. The O-antigens are essential lipopolysaccharides in gram-negative bacteria's outer membrane and have been linked to pathogenicity.
pfam14307	Glyco_tran_WbsX	1.00e-22	83	331	58	300	Glycosyltransferase WbsX. Members of this family are found in within O-antigen biosynthesis clusters in Gram negative bacteria, where they are predicted to function as glycosyltransferases.
cd11578	GH99_GH71_like_1	8.10e-14	33	349	1	310	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11573	GH99_GH71_like	4.21e-10	76	333	7	255	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11575	GH99_GH71_like_3	2.09e-07	72	187	54	170	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT58950.1	1.99e-261	1	349	1	349
QDF32023.1	1.73e-23	10	332	12	338
QJO55791.1	1.73e-23	10	332	12	338
AXZ29964.1	1.73e-23	10	332	12	338
AYW24128.1	1.73e-23	10	332	12	338

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999109	0.000204	0.000151	0.000136	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_00909.