CAZyme Information: MGYG000002560_01499

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_01499
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		55350.68	6.9007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 63981; End: 65420 Strand: +

Full Sequence      

MKKNFYTLLLLLSISLLAQGQTRRTSISLQHGAHRIGNRTDADMQRWREHGLGQFIHWGV
YAIPGGFWEGKCYPGAAEWIRSWKEMPKDAYDNLYKQFNPTAFDAKAWAKQAKQMGANYM
IFTTKHHDGFCLWPSKYTDYTIAHTPYKEDIVKQVVDAYTAEGIDVHLYFSIIDWNHKGY
RSAPPQTKQDSISYETFKEFTRNQLIELLTTYPSIKGLWFDGSWDKAWMNEAAWVDTLGM
ELRAMHPGLIIGSRFRADEHGKRHYDSNGDLIDDYDQTWERDLPNSMEDLHGSDWDCVMT
VPENQWGYHSEWRGYVKTSYDLLEMMVKAVSMNGNFVLNFGPDGKGTIRPEETKLAKEIG
DWMKINKEAIYGSSHSDIQKQDWGYFTQKGNKLYMCVFNKPINNLLKIEIPKGGIKPVKA
CFLEDNKEVEIQNAGKNKRNSSLYNVAIPVSYEAVRPFVIVLETVQNAKEEGEYQQAKI

Enzyme Prediction     

No EC number prediction in MGYG000002560_01499.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	38	372	3.3e-93	0.8959537572254336

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	4.53e-96	44	411	20	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	1.84e-79	47	368	22	333	Alpha-L-fucosidase.
COG3669	AfuC	1.00e-34	57	374	1	323	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	4.80e-08	104	184	1	80	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55143.1	5.08e-275	1	477	1	478
QIK60572.1	9.76e-273	1	477	1	478
QNL50619.1	1.06e-226	1	478	1	485
QEK99255.1	2.47e-225	2	478	3	485
ALJ06117.1	2.65e-213	11	464	21	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WVT_A	1.16e-155	24	463	3	438	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVT_B Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVU_A Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_B Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_C Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_D Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482]
4PCS_A	1.44e-155	27	463	2	434	Crystalstructure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_B Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_C Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_D Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_A Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_B Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_C Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_D Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482]
2XIB_A	1.63e-155	24	463	2	437	CrystalStructure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_C Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_D Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XII_A Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron],2XII_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron]
4WSJ_A	1.76e-155	27	463	2	434	Crystalstructure of a bacterial fucodiase in complex with 1-((1R,2R,3R,4R,5R,6R)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one [Bacteroides thetaiotaomicron VPI-5482],4WSJ_B Crystal structure of a bacterial fucodiase in complex with 1-((1R,2R,3R,4R,5R,6R)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one [Bacteroides thetaiotaomicron VPI-5482],4WSJ_C Crystal structure of a bacterial fucodiase in complex with 1-((1R,2R,3R,4R,5R,6R)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one [Bacteroides thetaiotaomicron VPI-5482],4WSJ_D Crystal structure of a bacterial fucodiase in complex with 1-((1R,2R,3R,4R,5R,6R)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one [Bacteroides thetaiotaomicron VPI-5482]
5I5R_A	1.83e-155	27	463	3	435	Crystalstructure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],5I5R_B Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],5I5R_C Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],5I5R_D Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49713	1.00e-32	52	405	39	382	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
P10901	3.68e-32	52	461	42	454	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
P04066	7.36e-32	52	411	58	413	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
P17164	1.31e-31	44	412	45	410	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q60HF8	1.41e-31	52	411	60	415	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000357	0.998808	0.000306	0.000184	0.000166	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_01499.