CAZyme Information: MGYG000002560_01870

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_01870
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000002560_8|CGC3	52556.96	6.5007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 139000; End: 140403 Strand: -

Full Sequence      

MNLRTLGMMGAILFLAGTGASAQKKKAAVNDSNTPLHLLQPEYKVPYGALTTGEVKADMD
RILRYLEQNTPTRVVDKNTGKVITDYANMTADAQLERGAFRLASYEWGVTYSAMLTAAQA
TGDPAYYKYVTDRFTFLAEVAPHFRRVLEKYGTVDPQMKQILTPHALDDAGAVCAAMVKA
QTADNSLNLNPLIENYMDFIMNKEYRLADGTFARTRPQHNTLWLDDMFMGIPPIACYSRM
AGDKQQMYMAEAVRQILQFADRMWVPEKGLFRHGWVEGMEDHPAFHWGRANGWALLTMCE
VLDVLPEDYPQRDKIMNLFRAHVRGLAALQSGEGFWHQLLDRNDSYLETSATAIYVYCFA
HAINKGWIDAMAYGPVAQLGWHAVTTQINAEGQVDGTCVGTGMAFDPAFYYYRPVNVYAA
HGYGPVIWAGAEMINLLNKQHPKMNDSAVQYYRTEQKTSEPIFHVVN

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	100	434	1.1e-89	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.60e-95	74	437	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.30e-47	105	437	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT56860.1	0.0	1	467	1	467
ALK86405.1	0.0	1	467	1	467
QEW35585.1	0.0	1	467	1	467
AII64718.1	0.0	1	467	1	467
QJR54147.1	0.0	1	467	1	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	4.14e-245	25	465	2	442	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	5.66e-24	191	416	132	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.64e-22	191	416	133	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
1NC5_A	2.77e-19	206	433	124	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.11e-18	206	433	114	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.52e-18	206	433	124	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	6.97e-18	223	434	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	3.08e-17	223	436	161	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	7.93e-16	154	403	60	305	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005754	0.773301	0.219715	0.000587	0.000343	0.000270

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_01870.