CAZyme Information: MGYG000002560_02229

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_02229
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671	MGYG000002560_11|CGC1	75640.89	5.2295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 97724; End: 99739 Strand: -

Full Sequence      

MKKIVRMLSLSGAVLCILNACTSPSGQTQVGNLLSQQSDFCNLINIKNVPQQERFYDAYV
FSDLGAWSAYALPENESNQYAGAFIGPMTMTGRGWIAGSLAEPKLKVNGEPYSLVRNVQT
VKYLPGRLVQEFNDEQLNFVTELCFGTSRTAVVRSIIKNVSQEPVTVSLSWNGGVFDKAS
VLSVADKNVSVLRLADSTCTVMRFCTADQVMLVNKDSLQAIEKSELVLQPNATYQSEYTQ
TMMLRGEDVQKELASLTTLDINACFDANKQRWNQNIASLLTGDSKYLNDNKYRRVLVKAM
MTLNSNWRSAAGDILHAGSNPSYNGFINGIWSWDSWKIASGNALYNPEMAKDEMRTLFDY
QAENGMVPDFISYNKKRNNWRDSKPPVAAWGAMNVYKATGDRAFLEEMFDKLYKFHQWWY
TDRDHDHNGICEYGSTDGTLIAAAWESGMDNGVRFDDAVMLKNGENAWSMNQENICLNSF
LYAEKNILAEMATILGKKELADQLIADAQKIKEHIQTKMFDKETGFFYDTRIETGEFIKV
MGAECWLPLWAGVATPEQAEQVMKKMMDPTKFNSTLPLGTLDISHPRLRPIRGYWRGPVW
VDQVYFGITGLRNYGYDKEADFLLEKFIDNAQGLTTDGPIHENYNPLTGETLNSPNFGWS
SALIIKMLLNK

Enzyme Prediction     

No EC number prediction in MGYG000002560_02229.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	13	668	1.4e-149	0.9754385964912281

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.39e-159	1	670	1	781	alpha-glucosidase; Provisional
pfam01204	Trehalase	5.42e-23	333	668	131	505	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	8.39e-21	278	669	238	604	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	2.45e-13	475	668	354	549	Neutral trehalase [Carbohydrate transport and metabolism].
PLN02567	PLN02567	2.11e-11	383	668	203	541	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00825.1	0.0	6	671	6	669
QQA30345.1	0.0	6	671	6	669
QUT61859.1	0.0	6	671	6	669
BBK86094.1	0.0	6	671	6	669
ABR38022.1	0.0	18	671	16	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.16e-95	39	662	4	747	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.15e-94	39	662	4	747	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.60e-94	39	662	4	747	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	7.11e-90	39	662	5	748	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	3.44e-47	441	662	41	296	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.94e-94	39	662	27	770	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.45e-24	331	668	98	485	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.47e-24	331	668	98	485	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	8.34e-16	330	668	39	445	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1
Q757L1	1.46e-07	469	649	467	667	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000074	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_02229.