CAZyme Information: MGYG000002560_02569

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_02569
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	MGYG000002560_15|CGC2	98891.23	5.4618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 47768; End: 50335 Strand: -

Full Sequence      

MMRKLQMLMILGCFPILLSAREYKEPEKVTLHQGWEFSQVGKGEWLPAKVPGTVHQDLIS
AGLLPDPFYGKNEEKVQWVENEDWMYRTTFNVTDEQLARDAAALQFEGLDTYADIYLNGA
LLERTDNMFVGYTIPVKEVLRKGENRLQVYFHSPIKQTLPQWETNGFDYPADNDHSDKRV
SIYSRKAPYSYGWDWGIRLVTSGIWRPVNLVYYDAAAIEDYYVRQASVTKELAKVENRLT
VNHIASAPQKAEVTVSYSYKDGEQVTEQKEVTLQPGSNEINLPIEIKNPHLWMPNGWGEP
ALYDVEAQVKMDGKAIATKKERIGLRTIKVVKEKDAQGESFYFEVNGQPMFAKGSNFIPD
DALLPNVTAERYHQLFKDVKDANMNMIRVWGGGVYEDDAFYKEADENGILVWQDFLFACT
TYPSDPTFLKRVEAEAEYNIKRLRNHASLAMWCGNNEIYEGMRYWGWDKKYTDPAIMEGM
KKGYDKLFRELLPRKVAELDPDRFYMHGSPYEANWGRPESWKIADSHNWGTWYGQKPFES
FDTEIPRFMSEYGFQAFPEMKTIATFASPEDYALESDVMNAHQKASTGNFLIKKTMGLYY
KVPEDFEQLVYLGLVLQGQGMRHGMEAHRRNRPYCMGTLYWQLNDSWPVVSWSSIDYYGN
WKAMHYQAQRAFAPVLVNAIKEGEDLAIYVMSDKLESDKEVTLQLRVMDFNGKVLDKKDI
KGEVPANASTLYYREKYEGMTSNPRNTFLLMTLKNKKGEVLSEEIYYFNYAKDQDLPKAD
IRYKVKPMDGKYEVTLSAKQLARDVFIEIPVQGARFTDNFFDLLPGQTKKVVITSDQLKK
NEKVEINIHQLSDTN

Enzyme Prediction     

No EC number prediction in MGYG000002560_02569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	734	1e-111	0.6981382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.22e-110	19	835	1	786	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	1.05e-19	684	773	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	3.21e-17	778	853	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.55e-16	216	326	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	1.82e-13	80	457	107	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDS02712.1	0.0	7	855	1	861
VTZ55336.1	0.0	1	855	1	855
ABR41741.1	0.0	1	855	1	855
QQY39980.1	0.0	1	855	1	855
ALK86220.1	0.0	1	855	1	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	0.0	27	854	7	837	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	27	854	9	839	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	0.0	27	854	7	837	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	0.0	27	854	9	839	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	27	854	7	837	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	4.81e-133	27	833	5	828	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	3.90e-131	27	833	5	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	1.08e-130	27	833	5	828	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B0YBU9	1.51e-130	27	833	5	828	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q0CCA0	2.01e-130	30	834	8	827	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000494	0.987239	0.011564	0.000252	0.000226	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_02569.